KEGG   Citrobacter sp. TBCP-5362: FD428_13460
Entry
FD428_13460       CDS       T10692                                 
Symbol
msbA
Name
(GenBank) lipid A ABC transporter ATP-binding protein/permease MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
ciq  Citrobacter sp. TBCP-5362
Pathway
ciq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ciq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FD428_13460 (msbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ciq02000]
    FD428_13460 (msbA)
Enzymes [BR:ciq01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     FD428_13460 (msbA)
Transporters [BR:ciq02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    FD428_13460 (msbA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N DEAD Zeta_toxin AAA_25 AAA_16 DUF87 AAA_22 AAA_29 nSTAND3 ABC_membrane_2 AAA_18 RsgA_GTPase APS_kinase AAA_30 Cytidylate_kin MMR_HSR1 SLFN-g3_helicase AAA_15 Activator-TraM
Other DBs
NCBI-ProteinID: QCQ71954
LinkDB
Position
complement(2805904..2807652)
AA seq 582 aa
MHNDKDLSTWQTFRRLWPTIAPFKTGLIVAGVALILNAASDAFMLSLLKPLLDDGFGKTD
RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS
TGTLLSRITYDSEQVASSSSGALITVVREGASIIALFIMMFYNSWQLSIILVILAPVVSI
AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ
GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIERSTGDLEFRNVTFTYPGRETPALR
NINLHIPAGKTVALVGRSGSGKSTIASLITRFYDINEGNILMDGHDLREYTLSSLRNQVA
LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFISKMDDGLDTVIGENGVL
LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQSALDELQKNRTSLVIAHRLS
TIEQADEIVVVEDGIIVERGTHRELLEQRGVYSQLHKMQFGQ
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcataacgataaagatctctctacgtggcagacgttccgccgactgtggcctaccatt
gcgcctttcaaaactgggctgatcgtggcgggtgtcgcgttgatcctcaatgcggccagc
gatgcttttatgttatcgctcctcaaaccattgctggacgatggttttggtaaaacagat
cgatcggtgctgctttggatgccgctggtggttattggcctgatgatattacgtggtatc
accagctatatttccagctactgtatttcatgggtatcgggcaaagtggtgatgaccatg
cgccgtcgtctgtttggtcatatgatggggatgcctgttgcattctttgataaacaatca
acggggacactgctttctcgtattacctatgactcagaacaggttgcgtcatcgtcttcc
ggggcgttgattacggtcgtgcgtgaaggtgcatcgatcatcgctttgtttatcatgatg
ttctataacagctggcaactgtcgatcattctggtcattctggcgcccgttgtgtctatt
gcgattcgcgtggtatcgaagcgttttcgtagcatcagtaaaaacatgcagaacacgatg
gggcaggtgaccaccagtgcagagcagatgctgaaaggccacaaagaagtgcttatcttt
ggcggtcaggaagttgaaacgaagcgttttgacaaagtcagcaataaaatgcgtctgcaa
gggatgaaaatggtgtctgcatcatccatctctgatccgatcattcagctgatcgcgtct
ctggcgctggcctttgttctctatgcggctagcttcccgagcgtaatggacagcctgact
gcgggtacgattaccgtcgtattctcatcaatgattgccctgatgcgtcctctgaaatcg
ctgaccaacgtcaatgcgcagttccagcgtggtatggcggcatgccagacgctgtttgct
attctggatagcgagcaagagaaagatgaaggcaaacgcgtaattgaacgttcgacaggc
gatctggaattccgcaatgtgacctttacctatccggggcgtgaaacgcctgcgctgcgc
aatatcaatctgcatattccggcgggtaagacggttgcactggtcgggcgttccggttca
ggtaaatcaaccattgccagtctgatcacgcgcttctacgacatcaatgaagggaatatc
ctgatggatggacacgatctgcgtgaatataccctgtcttcattgcgtaatcaggtcgcg
ctggtttcgcagaatgtgcacctgtttaacgatacggttgcgaacaacatcgcctatgcg
cgtactgaagagtacagccgcgagcaaattgaagaagcggcgcgtatggcgtatgccatg
gactttatcagcaagatggatgacggtctggatacggttatcggcgagaacggcgtactg
ctttccggtggccagcgtcagcgtatcgcgattgcccgtgcgttgctgcgtgacagccca
atcctgattctggatgaagccacttctgcgctggacaccgaatccgaacgcgcgattcag
tccgcgctggatgagttgcagaaaaaccgtacttcgctggttatcgcgcaccgtctttca
acgattgaacaagctgatgaaattgtcgtggtggaagacgggattattgttgagcgtgga
acccatcgcgaattgctggagcagcgcggtgtgtattcgcaactgcataaaatgcaattt
ggccaatga

DBGET integrated database retrieval system