Citrobacter sp. CFNIH10: C2U53_08095 Help Entry C2U53_08095       CDS       T05324                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cir  Citrobacter sp. CFNIH10 Pathway cir01100   Metabolic pathways cir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2U53_08095    00074 Mycolic acid biosynthesis     C2U53_08095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2U53_08095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA Motif Other DBs NCBI-ProteinID:  AUZ63798 UniProt:  A0A3S7D4C7 LinkDB All DBs Position 960887..961138 Genome browser AA seq 83 aa AA seqDB search MTDQYAIYNEVSALLVKLFEIDPQEIKPEARLYDDLELDSIDAVDMIVHLQKKTGKKIKP EEFKAVRTVQDVVDAVERLLKEA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgatcaatacgccatttataacgaagtctctgcgctgctggttaagctgtttgag atagacccgcaggagatcaaacctgaagcgcgtctgtacgacgatcttgagctggacagc atcgacgccgtcgacatgatcgtccatctgcaaaagaaaaccggtaagaagatcaaaccg gaagagttcaaagccgtacgcaccgtgcaggatgtcgttgacgcggtagaacgcctgctt aaagaagcctga

DBGET integrated database retrieval system