Citrobacter sp. CFNIH10: C2U53_15815 Help Entry C2U53_15815       CDS       T05324                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism cir  Citrobacter sp. CFNIH10 Brite KEGG Orthology (KO) [BR:cir00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cir03032]     C2U53_15815    03036 Chromosome and associated proteins [BR:cir03036]     C2U53_15815    03400 DNA repair and recombination proteins [BR:cir03400]     C2U53_15815 DNA replication proteins [BR:cir03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C2U53_15815 Chromosome and associated proteins [BR:cir03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C2U53_15815 DNA repair and recombination proteins [BR:cir03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C2U53_15815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AUZ65182 UniProt:  A0A3S5G4J5 LinkDB All DBs Position 2572846..2573118 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTG RNPQTGKEIAIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgatcgacaaaattgctgcaggggctgatatctccaaagctgcg gcagggcgtgcgttagacgcaattattgcttctgttaccgaatctctgaaagaaggggat gacgttgcgctggtaggttttggtacttttgctgttaaagagcgtgctgcccgtactggc cgcaacccgcaaacaggtaaagagatcgccattgctgccgccaaagtacctggtttccgt gcaggtaaagcactgaaagacgcagtaaactaa

DBGET integrated database retrieval system