Citrobacter sp. CFNIH10: C2U53_19950 Help Entry C2U53_19950       CDS       T05324                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cir  Citrobacter sp. CFNIH10 Pathway cir01100   Metabolic pathways cir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2U53_19950    00074 Mycolic acid biosynthesis     C2U53_19950   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2U53_19950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUZ67800 UniProt:  A0A3Q8DWM6 LinkDB All DBs Position 3360950..3361210 Genome browser AA seq 86 aa AA seqDB search MLNHEEVMDYTLECLQGMVESGVDIHPDSDLVNDLGLESIKVMDLLMLLEDKFDISIPIN ILLDVRTPAQLMEALIPYLESINESL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgttaaatcatgaagaagtaatggattacacccttgagtgtttacagggtatggtcgaa agcggcgtagatatccatcctgacagcgatctggttaatgatcttgggctggaatcgatt aaagttatggatttattaatgttgctggaagataaattcgacatttccatccctattaat attttgctggatgtcagaaccccggcgcaattaatggaagcgttaatcccttatctggag agtatcaatgagtctctatga

DBGET integrated database retrieval system