| Entry |
|
| Name |
(RefSeq) aspartate aminotransferase, mitochondrial-like isoform X1
|
| KO |
|
| Organism |
cit Citrus sinensis (Valencia orange)
|
| Pathway |
| cit00250 | Alanine, aspartate and glutamate metabolism |
| cit00270 | Cysteine and methionine metabolism |
| cit00330 | Arginine and proline metabolism |
| cit00400 | Phenylalanine, tyrosine and tryptophan biosynthesis |
| cit00710 | Carbon fixation by Calvin cycle |
| cit00950 | Isoquinoline alkaloid biosynthesis |
| cit00960 | Tropane, piperidine and pyridine alkaloid biosynthesis |
| cit01110 | Biosynthesis of secondary metabolites |
| cit01210 | 2-Oxocarboxylic acid metabolism |
|
| Module |
| cit_M00170 | C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type |
| cit_M00171 | C4-dicarboxylic acid cycle, NAD - malic enzyme type |
|
| Brite |
KEGG Orthology (KO) [BR:cit00001]
09100 Metabolism
09102 Energy metabolism
00710 Carbon fixation by Calvin cycle
102617696
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
102617696
00270 Cysteine and methionine metabolism
102617696
00220 Arginine biosynthesis
102617696
00330 Arginine and proline metabolism
102617696
00350 Tyrosine metabolism
102617696
00360 Phenylalanine metabolism
102617696
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
102617696
09110 Biosynthesis of other secondary metabolites
00950 Isoquinoline alkaloid biosynthesis
102617696
00960 Tropane, piperidine and pyridine alkaloid biosynthesis
102617696
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:cit01007]
102617696
Enzymes [BR:cit01000]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
102617696
Amino acid related enzymes [BR:cit01007]
Aminotransferase (transaminase)
Class I
102617696
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| Position |
6:join(17726379..17726549,17726851..17726936,17727623..17727829,17727971..17728076,17728419..17728523,17728603..17728775,17729260..17729419,17729543..17729638,17729806..17729900,17730071..17730179)
|
| AA seq |
435 aa
MYWRYLTRAARRCSVHTTSSRTVGWWDHVAPAAKDPINGVTEAFLADPSPYKINLGVGAY
RDDKGRPVVLQCVREAEAKIAGSEFLESISASVSTKMVEESVKLVYGKDSDVVKEGRSAG
VQALSGTGACRLFAEFQRRFHPESHIYFPDPTWSNHHNIWRDAQIPERTYHYYDPDSKSL
DFAALMDDIKNAPDSSFFLLHPSAHNPTGVDPTEEQWREISYQFKVKGHFPFFDMAYQGF
ASGDLDKDAQAIRIFLEDEHLIGCAQSYAKSMGLYGHRVGCLSILCVDSKQAAAIRSQIQ
QIARAMYGSPPVHGILLVATILSDPNLKSLWIDEVKIMADRIQRKRTTLRQNLEKLGSSL
NWEHITNQLGMFCFSGLTPYQVDRLAKEFHIYMTHDGRISMAGVTTGNVNYLANAIHEVT
RSEQETAKILCSISV |
| NT seq |
1308 nt +upstreamnt +downstreamnt
atgtactggagatatttgacaagagctgcaagaagatgcagtgttcatacaacttcatca
aggaccgttggatggtgggatcatgtggcccctgcagctaaggaccccattaacggtgtc
accgaggcctttcttgctgacccttctccctacaagatcaatcttggcgtgggagcttat
agggatgacaaagggaggcctgttgtgcttcagtgcgttcgagaagcagaggcaaagatc
gctggcagtgagttcctggaatcaatttctgcttctgttagcacaaaaatggttgaggag
agtgtaaaactggtttatggaaaggattcagatgtcgttaaagaggggaggtctgctgga
gttcaagctctgtctggcacaggtgcatgccgcctctttgctgagttccagaggcgtttc
catcctgaatcacatatttatttcccagatccaacttggtccaaccaccacaacatctgg
agagatgcccaaattccagagagaacctatcactactacgatcctgactcaaagagttta
gactttgcagcacttatggatgatataaagaatgctccagacagttcctttttcttactc
catccttctgctcacaacccaactggagtggaccctactgaagaacagtggagagaaatc
tcatatcaattcaaggtaaaaggtcattttcccttttttgacatggcttatcaaggtttt
gccagtggggatcttgacaaggatgctcaagctattcgtatttttcttgaagatgagcac
ttaataggctgcgctcagtcctacgcaaagagcatggggttgtatggacaccgagttggc
tgtctcagcatcctttgtgtggattcaaagcaagcagctgcaattagaagtcaaatacag
cagatagcgagagcgatgtatgggagccctcctgtccatggtatattactggtcgcgaca
atccttagtgacccaaacttgaagtcactttggattgatgaggtgaagattatggcagat
cgcattcaaagaaagcgaaccactcttcggcaaaatcttgaaaagttaggctcttctctc
aattgggagcatataaccaaccagctgggaatgttttgcttctccggcttaaccccatac
caggttgatcggctagcaaaggaattccacatatacatgactcacgatggccgtataagc
atggctggtgtaactacaggcaatgtcaattatctagcaaatgcaatacatgaagtcacc
agatctgagcaggaaacagccaagattctttgtagtattagtgtatag |