KEGG   Citrobacter sp. LUTT5: GUC46_18030
Entry
GUC46_18030       CDS       T10487                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
citr  Citrobacter sp. LUTT5
Pathway
citr00430  Taurine and hypotaurine metabolism
citr00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:citr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    GUC46_18030 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GUC46_18030 (tauD)
Enzymes [BR:citr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     GUC46_18030 (tauD)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: QHI84106
LinkDB
Position
complement(3736882..3737730)
AA seq 282 aa
MSERLNITPLGPYIGAQISGADLARPLSDNQFEQLYHAVLRHQVVFLREQVITPQQQRAL
ALRFGDLHIHPVYPHAEGVEEIIVLDTHNDNPPDNDNWHTDVTFIDTPPAGAILAAKELP
STGGDTLWTSGIAAYEALSEPFRQLLSGLRAEHDFRKSFQEYKYRKTPEEHLRWLEAVAK
HPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVTEKESEALLSFLFAHITKPEFQVRWRW
QPNDVAIWDNRVTQHYANADYLPQRRIMYRATILGDKPFYRA
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagtgaacgtctgaacataaccccgctggggccgtatattggcgcacaaatttctggt
gcggatttggcgcgtccgctgagcgataatcagtttgaacagctttatcacgcggtattg
cgccaccaggtggtgtttctgcgcgagcaggtgattacgccgcaacaacagcgggcgctg
gcgctgcgttttggcgatctgcatattcacccggtctatccgcatgccgaaggagtagaa
gaaattatcgtgctggatacccataacgataatccgccggataacgacaactggcacacc
gatgtcacctttatcgacacgccgcctgccggggcgattttagcggcgaaagagctgcca
tcaaccgggggcgacaccctgtggaccagtgggattgccgcttatgaagccttgtctgag
ccgttccgtcagttgctgagtggcctgcgggcagagcatgatttccgtaaatcatttcag
gaatataaatatcgcaagaccccagaggagcacctgcgctggctggaggccgtcgctaaa
catccaccgttgctgcatccggtggtgcgcacgcatccggtgagcgggaagcaggcgctg
ttcgtgaatgaaggatttaccacgcgaattgttgatgtcacggaaaaagagagcgaggcg
ttactgagctttttgttcgcgcatatcaccaaaccggagtttcaggtgcgctggcgctgg
cagcccaacgatgtggcgatttgggataatcgcgtgacgcagcattatgcgaatgcggat
tatctgccgcaacggcgcattatgtatcgggcaacgattctgggagataagccgttttat
cgggcgtga

DBGET integrated database retrieval system