Citrobacter tructae: E4Z61_06470 Help Entry E4Z61_06470       CDS       T07250                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism citz  Citrobacter tructae Brite KEGG Orthology (KO) [BR:citz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:citz03400]     E4Z61_06470 DNA repair and recombination proteins [BR:citz03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     E4Z61_06470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF4478 Motif Other DBs NCBI-ProteinID:  QBX80023 LinkDB All DBs Position complement(1225389..1225622) Genome browser AA seq 77 aa AA seqDB search MKVELTIDSMKEIPKSSVSVLAEVLLKRLENHYENCSLRVLRAGSDGLSIPGCEKEDKNK TEISLQETSESADNWFY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaagttgaattaaccattgatagcatgaaagaaattcctaaaagctcggtatctgta ctggcggaagtgttgctgaaaaggttagagaatcattatgaaaactgcagccttcgtgtg cttcgcgctggttctgatggattgagtatcccaggttgtgaaaaggaagataaaaataaa acagagatcagcctccaggagacctcggaaagtgctgacaattggttttattaa

DBGET integrated database retrieval system