Citrobacter sp. Y3: HAP28_09805 Help Entry HAP28_09805       CDS       T10856                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ciy  Citrobacter sp. Y3 Pathway ciy01100   Metabolic pathways ciy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ciy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HAP28_09805    00074 Mycolic acid biosynthesis     HAP28_09805   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HAP28_09805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIO39311 LinkDB All DBs Position 2089900..2090160 Genome browser AA seq 86 aa AA seqDB search MLNHEEVMDYTLECLQGMVESGVDIHPDSDLVNDLGLESIKVMDLLMLLEDKFDISIPIN ILLDVRTPAQLMEALIPYLESINESL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgttaaatcatgaagaagtaatggattacacccttgagtgtttacagggtatggtcgaa agcggcgtagatatccatcctgacagcgatctggttaatgatcttgggctggaatcgatt aaagttatggatttattaatgttgctggaagataaattcgacatttccatccctattaat attttgctggatgtcagaaccccggcgcaattaatggaagcgttaatcccttatctggag agtatcaatgagtctctatga

DBGET integrated database retrieval system