Citrobacter sp. Y3: HAP28_22385 Help Entry HAP28_22385       CDS       T10856                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ciy  Citrobacter sp. Y3 Pathway ciy02024   Quorum sensing ciy03018   RNA degradation Brite KEGG Orthology (KO) [BR:ciy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HAP28_22385 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HAP28_22385 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ciy03019]     HAP28_22385 (hfq)    03036 Chromosome and associated proteins [BR:ciy03036]     HAP28_22385 (hfq) Messenger RNA biogenesis [BR:ciy03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HAP28_22385 (hfq) Chromosome and associated proteins [BR:ciy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HAP28_22385 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Herpes_capsid LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QIO41573 LinkDB All DBs Position complement(4622098..4622406) Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTSSNYHHGSGAQGSAAQQDSEETE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaaggtcaaatcgagtcttttgat cagtttgtgatcctgttgaaaaacacggtcagtcagatggtttataagcacgcgatttct actgttgtcccgtctcgcccggtttctcatcatagtaacaatgccggtggcggtaccagc agtaactatcatcacggtagcggcgcgcagggttctgcggcgcaacaggacagcgaagag accgaataa

DBGET integrated database retrieval system