Cellvibrio japonicus: CJA_0101 Help Entry CJA_0101          CDS       T00721                                  Symbol acpC Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cja  Cellvibrio japonicus Pathway cja01100   Metabolic pathways cja01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cja00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJA_0101 (acpC)    00074 Mycolic acid biosynthesis     CJA_0101 (acpC)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJA_0101 (acpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ER Motif Other DBs NCBI-ProteinID:  ACE84181 UniProt:  B3PFI5 LinkDB All DBs Position complement(144288..144566) Genome browser AA seq 92 aa AA seqDB search MSLQTPQEQELATLLVSALDLEDLEPGDINPEAPLFDASHSDSLGLDSIDALEISLAVAK HYKVQLKADDENNKAIFYSLRSLSHYINEQRA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagtctacagacaccacaagaacaagagctggcaaccctgttggtttccgcattggac ctggaagacctggagccaggcgatatcaacccggaagctcctttgtttgacgccagccac agtgacagcctggggctggattcaattgatgcgctggaaatatccctggcagtcgccaag cactacaaggtgcagctcaaagccgacgatgaaaacaacaaggccatcttctatagtctg cgctcgctcagtcactatataaacgagcaacgtgcttaa

DBGET integrated database retrieval system