Cellvibrio japonicus: CJA_1375 Help Entry CJA_1375          CDS       T00721                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism cja  Cellvibrio japonicus Pathway cja00190   Oxidative phosphorylation cja01100   Metabolic pathways cja02020   Two-component system Module cja_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:cja00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CJA_1375  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CJA_1375 Enzymes [BR:cja01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      CJA_1375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB PIGBOS1 Motif Other DBs NCBI-ProteinID:  ACE84394 UniProt:  B3PD11 LinkDB All DBs Position 1601677..1601790 Genome browser AA seq 37 aa AA seqDB search MWYFTWILGVLLACAFGIINAMWLENAVTDQGHGRQE NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctggattctcggcgtattgctggcctgtgcgtttggtattatcaat gccatgtggcttgaaaacgccgtgactgaccagggacatggtcggcaagagtag

DBGET integrated database retrieval system