KEGG   Cellvibrio japonicus: CJA_2313
Entry
CJA_2313          CDS       T00721                                 
Name
(GenBank) ABC-transport protein, ATP-binding component
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
cja  Cellvibrio japonicus
Pathway
cja02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cja00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CJA_2313
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cja02000]
    CJA_2313
Transporters [BR:cja02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    CJA_2313
SSDB
Motif
Pfam: ABC_membrane ABC_tran AAA_22 SMC_N Zeta_toxin AAA_15
Other DBs
NCBI-ProteinID: ACE85869
UniProt: B3PJV1
LinkDB
Position
complement(2652670..2654574)
AA seq 634 aa
MTMPASPSPLSSSLLNDQPAGRFPGGGGRLGTPDQDGVNLDDDIFIRFDSGIMGRLWGYI
RPYRLPLTGCMLAVVLYALVQVAIPLAIRGVVDNAAETAALSTVLPLSTALPFALAIFAV
LVLLNFAFNFLQEWGTARIAQRVIFNLRRAMFAHLQQVSLGLLDQTQVGRLMARLQGDVN
ALQEFMESSISALGDLCLLLGIVVVLLVLDWQLGLLTLAVLPVLVLIRLVWLPWARRQFR
RAREASSRVNSALAENINGIRTVQENRRESFNFNRYEPIARENLDAQLGSSRASQIMVPS
VDILTGFAMAIVVVAGGVAVLHSRVEVGVMVAYLFYVQRFFDPIRTLSMQYTVLQRAMAA
AYRIFEVLDLPVTLQDKPNARVLDNPVPDIEFRAVTFGYKPNQPVLHNISFHIAPYTTAA
LVGPTGSGKTSITALLHRFYDVWQGQVLIDGQDVRDLTQDSLGHVIGMVLQEPFLFSGSI
MDNLRYGSTNASDEEVIAAAKAVRAHDFIERLPQGYQTPLGQRGRNLSIGQRQLLSFART
LLMNPRILILDEATANIDSFTEAEIQRALRVLCAGRTSIIIAHRLATIRAADQILVLNHG
RLVEQGNHQQLMQQGGLYYQLNTSNQSSFDELAD
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgactatgccggcttctccttcacccttgtcatcgtccttgcttaacgatcaacctgcg
gggcgtttcccgggcggtggcggtcgtttgggtactcccgaccaggatggtgtcaacctt
gacgatgatatttttatccgttttgacagcggcattatgggacgtttgtggggttatatc
cgcccttatcgattgccattaacgggctgcatgttagctgtggtgctttacgccctggta
caggttgcaatccctctggcaattcgcggcgtagtggataatgcggcggaaaccgctgca
ctatccacagtgctgccattatccacagcgctgccatttgccctggcgatatttgctgtg
ctggtactattgaattttgcgtttaatttcctgcaggagtggggcactgcacgtattgcc
cagcgagtcatttttaatttgcgccgcgccatgtttgcccatttacagcaggtgtctttg
ggcctgcttgaccaaacccaggtagggcgcctgatggcgcgcttgcagggcgatgtaaat
gccttgcaggaatttatggagagttccatttctgcgctgggtgatctatgcctgctgttg
ggaattgttgtggtgctgttggtgctcgattggcagttgggattgctgacgctggcagta
ttgcccgtattggtcttgatccgcctggtgtggctgccctgggccaggcgccagtttcgc
cgcgcgcgcgaggcatcgtcgcgcgtcaactccgcacttgcagaaaatatcaatggtatt
cgcactgtgcaggaaaaccgccgcgaatccttcaactttaatcgctatgaacctatagcg
cgggaaaacctggacgcccagctgggctcgtcgcgcgcctcgcagatcatggtgccgagt
gtggatatcctcaccgggtttgccatggccatcgtggtggtggcaggtggtgtagcggta
ttgcacagccgtgtggaggttggtgtgatggttgcttacctgttttatgtgcagcgcttt
ttcgatcccattcgcaccctgtctatgcaatacacggtattgcagcgcgccatggccgcg
gcctaccggattttcgaagtattggatttgccggtcaccctgcaggataagcccaatgcg
cgcgtgctggataatccagtgccggatattgagttccgtgcagtgacttttggttacaaa
cccaatcaaccggtattgcacaacatcagttttcatatcgcaccttataccaccgctgca
ctggtcggccccaccggctcgggcaaaaccagtattactgctttgttgcaccgtttttat
gatgtatggcaagggcaggtattgattgatggacaggatgtgcgcgaccttacccaggat
tccctcggccatgtgattggcatggtgttacaggagccgtttttattttctggcagcatt
atggataacctgcgttacggttctacaaacgccagtgatgaagaggtgattgccgcagcc
aaagccgtgcgcgcccacgattttattgaacgcctgccccaggggtaccaaaccccgctg
ggccagcgcggtcgcaacctgtcgattggccagcgccagttgctgagttttgcccgcacc
ttgttgatgaatccgcgcatacttatcctcgatgaggccaccgccaatatcgacagcttt
accgaggcggaaatccagcgcgcactgcgtgtactctgcgcaggtcgcaccagtattatc
attgcccatcgcctggcaaccatccgcgcagcagaccaaatactggtgctaaaccatggt
cgcctggtggagcagggcaaccatcaacagttaatgcagcagggtggtttgtattaccag
ctcaataccagtaaccaatcatcgtttgatgagttggcggattga

DBGET integrated database retrieval system