Cellvibrio japonicus: CJA_3079 Help Entry CJA_3079          CDS       T00721                                  Symbol hfq Name (GenBank) Hfq protein   KO K03666   host factor-I protein Organism cja  Cellvibrio japonicus Pathway cja02024   Quorum sensing cja03018   RNA degradation Brite KEGG Orthology (KO) [BR:cja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CJA_3079 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CJA_3079 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cja03019]     CJA_3079 (hfq)    03036 Chromosome and associated proteins [BR:cja03036]     CJA_3079 (hfq) Messenger RNA biogenesis [BR:cja03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CJA_3079 (hfq) Chromosome and associated proteins [BR:cja03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CJA_3079 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ACE86363 UniProt:  B3PDC1 LinkDB All DBs Position complement(3658955..3659221) Genome browser AA seq 88 aa AA seqDB search MSKGHSLQDPYLNVLRKERVPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAIS TVVPSRAVRVPLLNEAGGAEGEEDEQAE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcatagtttacaagacccttacctgaacgttctgcgcaaagagcgtgtg cctgtatcgatttacctggtaaacggtatcaagttacaaggccaggttgagtcctttgac cagttcgttgtactgctcaaaaacacagtaagccaaatggtttacaaacatgctatctct accgttgtcccgtctcgtgctgttcgtgttcctttgctgaatgaagcgggcggtgctgaa ggcgaagaagacgagcaagccgagtaa

DBGET integrated database retrieval system