Cellvibrio japonicus: CJA_3556 Help Entry CJA_3556          CDS       T00721                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism cja  Cellvibrio japonicus Brite KEGG Orthology (KO) [BR:cja00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cja03110]     CJA_3556 (grxC) Chaperones and folding catalysts [BR:cja03110]  Protein folding catalysts   Protein disulfide isomerase    CJA_3556 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_3 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  ACE85668 UniProt:  B3PGW1 LinkDB All DBs Position 4246142..4246399 Genome browser AA seq 85 aa AA seqDB search MARVLMYTTAVCPYCNNAKKLLAEKGVVPEEIRIDTQPQLRQEMMAKSGQRTVPQIWIND FHVGGFTDLWALDKAGKLDALLAQH NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcccgtgtgttgatgtacaccaccgctgtttgcccctactgcaataacgccaagaag ttgctggcggagaaaggcgtggtgcccgaggaaatccgtatagacacgcaaccgcagctg cgccaggaaatgatggccaaaagcggccagcgcacggtgccgcagatctggatcaacgat ttccatgtaggcggttttaccgacctctgggcgctggataaagccggcaaactggatgcg cttctggctcaacactga

DBGET integrated database retrieval system