Caldichromatium japonicum: GWK36_08840 Help Entry GWK36_08840       CDS       T07151                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cjap  Caldichromatium japonicum Pathway cjap01100   Metabolic pathways cjap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cjap00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GWK36_08840 (acpP)    00074 Mycolic acid biosynthesis     GWK36_08840 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GWK36_08840 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QIK38072 UniProt:  A0A6G7VDP1 LinkDB All DBs Position complement(1806800..1807036) Genome browser AA seq 78 aa AA seqDB search MSSVEERVRKIVVDQLGVKEEEVTPEASFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKITTVQQAIDYINAHLS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcgttgaagaacgggttcgcaaaatcgtggtcgatcagctcggcgtcaaagaa gaagaggtgacgccagaggcgtcgttcgtcgatgatctaggggcggactcgctcgatacc gtcgaactggtgatggcgctggaagaggagttcgagaccgagatcccggatgaggacgcc gagaagatcacgacggtccagcaggccatcgattatatcaatgcacatctgtcctga

DBGET integrated database retrieval system