KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385465
Entry
100385465         CDS       T03264                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100385465 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100385465 (TNFRSF8)
   04090 CD molecules [BR:cjc04090]
    100385465 (TNFRSF8)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100385465 (TNFRSF8)
CD molecules [BR:cjc04090]
 Proteins
  100385465 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100385465
NCBI-ProteinID: XP_008998663
Ensembl: ENSCJAG00000013559
LinkDB
Position
7:46853020..46895422
AA seq 487 aa
MFCAMSAVNSCARCFLHSVCPAGMIVKFPGTAQKNTVCEPAPTGVSAACASPENCKNPTS
GTILQAKPTLVSPATSNASTMPISGVAHLAQEAASKLTMAPDAPSSAGWPSSHPGPPPTQ
PCPQGSGECRKQCEPDYYLDRTGRCTACVSCSRDDLVEKKPCAWNSSRICECRPGMFCAM
LVTNSCARCVPYPICAAEMVTKPQDVAERDTTLEPPTPVTPDCILTPENGKTPASTSPTL
SSLVDSQASKTLPIPTSAPIALSSTGKPILDPEPVLFWVSLVLAVVVGASVFLLCHRRAC
RKRIRQKLHLCYPVQTSRPKLELVDSRPRRSSTQVRSGGLVTESLAEELQLMSPPAQPLE
ICHNVGAASLESLPLRDASPAGDPSPPRDLPEPRVPTEHTNNRIEKIYIMKADTVIVGTV
KAELPEGRGLAGPAERELEEEELEADHAPHYPEQETEPPLGSCGDIAMLSVEEEGKEAPL
PTAACGK
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgttctgtgccatgtctgcagtcaactcctgtgcccgctgcttcctccactccgtctgc
ccagcagggatgattgtcaagttcccaggcacagcacagaagaacactgtctgtgagccg
gctcccacaggggtcagcgctgcctgtgccagcccagagaactgcaaaaaccccaccagt
ggcaccatcctccaggccaagcccactctggtgtccccagcaacttctaatgccagcacc
atgcctataagcggggtcgcccacctcgcccaggaagctgcttctaaactgacaatggct
cccgatgctccctcctctgcaggatggcctagttcacatccaggtccgcccccaacacag
ccgtgtccacaggggtccggcgagtgtaggaagcagtgtgaaccagactactacctggac
aggaccggccgctgcacagcctgtgtgagctgttctcgagatgacctcgtggagaagaag
ccatgtgcatggaactcctcccgcatctgcgaatgtcgacctggcatgttctgtgccatg
ttagtcaccaactcctgtgcccgctgtgtcccctacccgatctgtgcagcagagatggtc
accaagccccaggatgtagctgagagggacaccacccttgagccgccaaccccagtgacc
cctgactgcatcctcaccccagagaatggcaagacgcctgccagcaccagccccaccctg
agctccctggtggattcccaagccagtaagacactgcccatcccaaccagcgctcccatc
gctctctcctccacggggaagcccattctggatccagagccggtgctcttctgggtgagc
ctggtgctcgccgtggtggttggcgccagcgtcttcctcctgtgccaccggagggcctgc
aggaagcgaattcggcagaagctccacctgtgctacccggtccagacctcccggcccaag
ctggagcttgtggattccagacccaggaggagctcaacacaggtgaggagtggcgggttg
gtgacagaatccctcgcagaagagctgcagttaatgagccctccagcgcagccattggag
atctgccacaacgtgggggcagctagcctggagagcctgccattgcgggatgccagccca
gccggagatccctcacctcccagggaccttcctgagcctcgggtgcccacggaacacacc
aataacaggattgagaaaatctacatcatgaaggctgacaccgtgattgtggggaccgtg
aaggctgagctgcccgagggccggggcctggcggggccagcagagcgcgagttggaggag
gaggagctggaggcagaccatgccccacactaccccgagcaggagacagaaccgcctctg
ggcagctgtggcgacattgccatgctctcggtggaagaggaagggaaggaggcccccttg
cccacagctgcctgtggaaagtga

DBGET integrated database retrieval system