KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394221
Entry
100394221         CDS       T03264                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04927  Cortisol synthesis and secretion
cjc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100394221 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100394221 (MRAP)
SSDB
Motif
Pfam: MRAP DUF420
Other DBs
NCBI-GeneID: 100394221
NCBI-ProteinID: XP_002761413
LinkDB
Position
21:36332344..36356739
AA seq 174 aa
MVNGTNASAPYYSYEYYLDYLDLIPVDEKKLQAHKYSIVIALWVSLAAFVMLLFLILLYM
SWSGFPQTKNSPKHHQTCPWSHSLNLHLCIPKCLPCRYRREPQGTSQALVHSVEPGSRTG
SDQPLRQESSSTLPPGVFQTHPTLLWEMTLDGAPLVRSKPSKPPPGDRNSQLQN
NT seq 525 nt   +upstreamnt  +downstreamnt
atggtcaatgggacaaatgcctctgccccatactatagctatgaatactacctggactat
ctggacctcattcccgtggacgagaagaagctgcaagctcacaaatattccatcgtcatc
gcactctgggtgagcctggctgctttcgtgatgctcctcttcctcattctgctctacatg
tcctggtcgggcttcccgcagacgaagaacagccccaagcaccaccaaacatgcccctgg
agtcacagcctcaaccttcacctctgcatcccgaagtgcctgccgtgccgctaccgcagg
gaaccccaggggacctcacaggctctggtgcactcagtggagccagggagcagaactggc
tctgaccagccgctaagacaggagagctcctccaccttgcccccaggggtcttccagacg
caccccactctcctctgggaaatgaccctcgatggggctcctctcgtcaggagcaagccc
agcaagcctccccctggagacaggaactctcaattgcagaactga

DBGET integrated database retrieval system