Entry |
|
Symbol |
PRKACA
|
Name |
(RefSeq) LOW QUALITY PROTEIN: cAMP-dependent protein kinase catalytic subunit alpha
|
KO |
|
Organism |
cjc Callithrix jacchus (white-tufted-ear marmoset)
|
Pathway |
cjc04213 | Longevity regulating pathway - multiple species |
cjc04261 | Adrenergic signaling in cardiomyocytes |
cjc04270 | Vascular smooth muscle contraction |
cjc04723 | Retrograde endocannabinoid signaling |
cjc04750 | Inflammatory mediator regulation of TRP channels |
cjc04914 | Progesterone-mediated oocyte maturation |
cjc04919 | Thyroid hormone signaling pathway |
cjc04923 | Regulation of lipolysis in adipocytes |
cjc04925 | Aldosterone synthesis and secretion |
cjc04927 | Cortisol synthesis and secretion |
cjc04928 | Parathyroid hormone synthesis, secretion and action |
cjc04935 | Growth hormone synthesis, secretion and action |
cjc04961 | Endocrine and other factor-regulated calcium reabsorption |
cjc04962 | Vasopressin-regulated water reabsorption |
cjc05163 | Human cytomegalovirus infection |
cjc05166 | Human T-cell leukemia virus 1 infection |
cjc05207 | Chemical carcinogenesis - receptor activation |
|
Brite |
KEGG Orthology (KO) [BR:cjc00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
100400737 (PRKACA)
04014 Ras signaling pathway
100400737 (PRKACA)
04310 Wnt signaling pathway
100400737 (PRKACA)
04340 Hedgehog signaling pathway
100400737 (PRKACA)
04371 Apelin signaling pathway
100400737 (PRKACA)
04020 Calcium signaling pathway
100400737 (PRKACA)
04024 cAMP signaling pathway
100400737 (PRKACA)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
100400737 (PRKACA)
04081 Hormone signaling
100400737 (PRKACA)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
100400737 (PRKACA)
09143 Cell growth and death
04114 Oocyte meiosis
100400737 (PRKACA)
09144 Cellular community - eukaryotes
04530 Tight junction
100400737 (PRKACA)
04540 Gap junction
100400737 (PRKACA)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
100400737 (PRKACA)
04062 Chemokine signaling pathway
100400737 (PRKACA)
09152 Endocrine system
04911 Insulin secretion
100400737 (PRKACA)
04910 Insulin signaling pathway
100400737 (PRKACA)
04922 Glucagon signaling pathway
100400737 (PRKACA)
04923 Regulation of lipolysis in adipocytes
100400737 (PRKACA)
04912 GnRH signaling pathway
100400737 (PRKACA)
04913 Ovarian steroidogenesis
100400737 (PRKACA)
04915 Estrogen signaling pathway
100400737 (PRKACA)
04914 Progesterone-mediated oocyte maturation
100400737 (PRKACA)
04921 Oxytocin signaling pathway
100400737 (PRKACA)
04926 Relaxin signaling pathway
100400737 (PRKACA)
04935 Growth hormone synthesis, secretion and action
100400737 (PRKACA)
04918 Thyroid hormone synthesis
100400737 (PRKACA)
04919 Thyroid hormone signaling pathway
100400737 (PRKACA)
04928 Parathyroid hormone synthesis, secretion and action
100400737 (PRKACA)
04916 Melanogenesis
100400737 (PRKACA)
04924 Renin secretion
100400737 (PRKACA)
04925 Aldosterone synthesis and secretion
100400737 (PRKACA)
04927 Cortisol synthesis and secretion
100400737 (PRKACA)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
100400737 (PRKACA)
04270 Vascular smooth muscle contraction
100400737 (PRKACA)
09154 Digestive system
04970 Salivary secretion
100400737 (PRKACA)
04971 Gastric acid secretion
100400737 (PRKACA)
04976 Bile secretion
100400737 (PRKACA)
09155 Excretory system
04962 Vasopressin-regulated water reabsorption
100400737 (PRKACA)
04961 Endocrine and other factor-regulated calcium reabsorption
100400737 (PRKACA)
09156 Nervous system
04724 Glutamatergic synapse
100400737 (PRKACA)
04727 GABAergic synapse
100400737 (PRKACA)
04725 Cholinergic synapse
100400737 (PRKACA)
04728 Dopaminergic synapse
100400737 (PRKACA)
04726 Serotonergic synapse
100400737 (PRKACA)
04720 Long-term potentiation
100400737 (PRKACA)
04723 Retrograde endocannabinoid signaling
100400737 (PRKACA)
09157 Sensory system
04740 Olfactory transduction
100400737 (PRKACA)
04742 Taste transduction
100400737 (PRKACA)
04750 Inflammatory mediator regulation of TRP channels
100400737 (PRKACA)
09149 Aging
04211 Longevity regulating pathway
100400737 (PRKACA)
04213 Longevity regulating pathway - multiple species
100400737 (PRKACA)
09159 Environmental adaptation
04713 Circadian entrainment
100400737 (PRKACA)
04714 Thermogenesis
100400737 (PRKACA)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100400737 (PRKACA)
05205 Proteoglycans in cancer
100400737 (PRKACA)
05207 Chemical carcinogenesis - receptor activation
100400737 (PRKACA)
05203 Viral carcinogenesis
100400737 (PRKACA)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
100400737 (PRKACA)
05163 Human cytomegalovirus infection
100400737 (PRKACA)
05165 Human papillomavirus infection
100400737 (PRKACA)
09174 Infectious disease: parasitic
05146 Amoebiasis
100400737 (PRKACA)
09164 Neurodegenerative disease
05012 Parkinson disease
100400737 (PRKACA)
05020 Prion disease
100400737 (PRKACA)
09165 Substance dependence
05030 Cocaine addiction
100400737 (PRKACA)
05031 Amphetamine addiction
100400737 (PRKACA)
05032 Morphine addiction
100400737 (PRKACA)
05034 Alcoholism
100400737 (PRKACA)
09166 Cardiovascular disease
05414 Dilated cardiomyopathy
100400737 (PRKACA)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
100400737 (PRKACA)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
100400737 (PRKACA)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:cjc01001]
100400737 (PRKACA)
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:cjc03019]
100400737 (PRKACA)
03036 Chromosome and associated proteins [BR:cjc03036]
100400737 (PRKACA)
Enzymes [BR:cjc01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.11 cAMP-dependent protein kinase
100400737 (PRKACA)
Protein kinases [BR:cjc01001]
Serine/threonine kinases: AGC group
PKA family
100400737 (PRKACA)
Messenger RNA biogenesis [BR:cjc03019]
Eukaryotic type
mRNA surveillance and transport factors
mRNA cycle factors
Common to processing body (P body) and stress granule
100400737 (PRKACA)
Chromosome and associated proteins [BR:cjc03036]
Eukaryotic type
Centrosome formation proteins
Kinases and associated factors
100400737 (PRKACA)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
22:complement(12525389..12551826)
|
AA seq |
431 aa
MSGGLRGRHGRQQRTWAEVPGRAGAERRGKQGLGGGRGAAASAASPRAAAAAAQRAPGPP
AAASTRNAAAPGPAPAAAAAMGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAH
LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVN
FPFLVRLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS
LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAV
DWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK
RFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSI
NEKCGKEFNEF |
NT seq |
1296 nt +upstreamnt +downstreamnt
atgagcggcgggctgcgggggcgtcacggacggcagcagcggacttgggctgaggttccc
gggcgggcgggcgcggagagacgcgggaagcaggggctgggcgggggtcgcggcgccgca
gctagcgcagccagcccgagggccgccgccgccgccgcccagcgcgctccggggccgccg
gccgccgccagcacccgcaacgccgcagctccgggaccggccccggccgccgccgccgcg
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtaatgctg
gtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtaaagctgaaacagatagaacacaccctgaatgaaaagcgcatcctgcaagccgtcaac
tttccgttcctcgtcagactggagttctccttcaaggacaactcaaacttatacatggtc
atggagtacgtgcctggcggggagatgttctcacacctacggcggattggaaggttcagt
gagccccatgcccgtttctacgcggcccagatcgtcctgaccttcgaatatctgcactcg
ctggatctcatctacagggacctgaagccagagaatctgctcatcgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgtgtgaagggccgcacttggaccttatgt
gggacccctgagtacctggcccccgagatcatcctgagcaaaggctacaacaaggctgtg
gactggtgggccctaggggttcttatctatgagatggccgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctggaaaggtgcggttcccttcc
cacttcagctctgacttgaaggacctcctgcggaacctcctgcaggtagatctcaccaag
cgctttgggaacctcaagaatggggtcaacgatatcaagaaccacaagtggtttgccacg
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagtttaatgagttttag |