KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100895294
Entry
100895294         CDS       T03264                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04145  Phagosome
cjc04148  Efferocytosis
cjc04151  PI3K-Akt signaling pathway
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04613  Neutrophil extracellular trap formation
cjc04620  Toll-like receptor signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04932  Non-alcoholic fatty liver disease
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04972  Pancreatic secretion
cjc05014  Amyotrophic lateral sclerosis
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05100  Bacterial invasion of epithelial cells
cjc05132  Salmonella infection
cjc05135  Yersinia infection
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05208  Chemical carcinogenesis - reactive oxygen species
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05231  Choline metabolism in cancer
cjc05415  Diabetic cardiomyopathy
cjc05416  Viral myocarditis
cjc05417  Lipid and atherosclerosis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100895294
   04014 Ras signaling pathway
    100895294
   04015 Rap1 signaling pathway
    100895294
   04310 Wnt signaling pathway
    100895294
   04370 VEGF signaling pathway
    100895294
   04071 Sphingolipid signaling pathway
    100895294
   04024 cAMP signaling pathway
    100895294
   04151 PI3K-Akt signaling pathway
    100895294
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100895294
   04148 Efferocytosis
    100895294
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100895294
   04520 Adherens junction
    100895294
   04530 Tight junction
    100895294
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100895294
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100895294
   04620 Toll-like receptor signaling pathway
    100895294
   04650 Natural killer cell mediated cytotoxicity
    100895294
   04662 B cell receptor signaling pathway
    100895294
   04664 Fc epsilon RI signaling pathway
    100895294
   04666 Fc gamma R-mediated phagocytosis
    100895294
   04670 Leukocyte transendothelial migration
    100895294
   04062 Chemokine signaling pathway
    100895294
  09154 Digestive system
   04972 Pancreatic secretion
    100895294
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100895294
  09158 Development and regeneration
   04360 Axon guidance
    100895294
   04380 Osteoclast differentiation
    100895294
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100895294
   05205 Proteoglycans in cancer
    100895294
   05208 Chemical carcinogenesis - reactive oxygen species
    100895294
   05203 Viral carcinogenesis
    100895294
   05231 Choline metabolism in cancer
    100895294
  09162 Cancer: specific types
   05210 Colorectal cancer
    100895294
   05212 Pancreatic cancer
    100895294
   05211 Renal cell carcinoma
    100895294
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100895294
   05163 Human cytomegalovirus infection
    100895294
   05167 Kaposi sarcoma-associated herpesvirus infection
    100895294
   05169 Epstein-Barr virus infection
    100895294
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100895294
   05135 Yersinia infection
    100895294
   05100 Bacterial invasion of epithelial cells
    100895294
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100895294
   05020 Prion disease
    100895294
   05022 Pathways of neurodegeneration - multiple diseases
    100895294
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100895294
   05418 Fluid shear stress and atherosclerosis
    100895294
   05415 Diabetic cardiomyopathy
    100895294
   05416 Viral myocarditis
    100895294
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100895294
   04933 AGE-RAGE signaling pathway in diabetic complications
    100895294
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100895294
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100895294
   04031 GTP-binding proteins [BR:cjc04031]
    100895294
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100895294
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100895294
  Macropinocytosis
   Ras GTPases
    100895294
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100895294
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100895294
  Exosomal proteins of other body fluids (saliva and urine)
   100895294
  Exosomal proteins of colorectal cancer cells
   100895294
  Exosomal proteins of bladder cancer cells
   100895294
GTP-binding proteins [BR:cjc04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100895294
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 100895294
NCBI-ProteinID: XP_054092302
LinkDB
Position
7:94390996..94391888
AA seq 192 aa
MQAIKCVVVGDGVVGKTCLLLSYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPXSYPLTDVFLICFSLVSPASFENVRAKWYPEVRHHCPKTPIILVGPKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLEGSALTQRGLKTVFDEAIPAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagttgtaggtaaaacttgcctactg
ctcagttacacaaccaatgcatttcctggagaatatattcctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccncatcctatccgctaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaaaactcccatcatcctagtgggacctaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaagagaagaagctgactccgatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatacctggagggctccgcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatcccagcagttctctgcccacct
cccgtgaagaagaggaagaggaaatgcctgctgctgtaa

DBGET integrated database retrieval system