KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108591807
Entry
108591807         CDS       T03264                                 
Name
(RefSeq) GTPase NRas-like
  KO
K07828  GTPase NRas
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04062  Chemokine signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04625  C-type lectin receptor signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04929  GnRH secretion
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04935  Growth hormone synthesis, secretion and action
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05034  Alcoholism
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05207  Chemical carcinogenesis - receptor activation
cjc05208  Chemical carcinogenesis - reactive oxygen species
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05216  Thyroid cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108591807
   04012 ErbB signaling pathway
    108591807
   04014 Ras signaling pathway
    108591807
   04015 Rap1 signaling pathway
    108591807
   04370 VEGF signaling pathway
    108591807
   04371 Apelin signaling pathway
    108591807
   04068 FoxO signaling pathway
    108591807
   04072 Phospholipase D signaling pathway
    108591807
   04071 Sphingolipid signaling pathway
    108591807
   04151 PI3K-Akt signaling pathway
    108591807
   04150 mTOR signaling pathway
    108591807
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108591807
   04137 Mitophagy - animal
    108591807
  09143 Cell growth and death
   04210 Apoptosis
    108591807
   04218 Cellular senescence
    108591807
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108591807
   04550 Signaling pathways regulating pluripotency of stem cells
    108591807
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108591807
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108591807
   04650 Natural killer cell mediated cytotoxicity
    108591807
   04660 T cell receptor signaling pathway
    108591807
   04662 B cell receptor signaling pathway
    108591807
   04664 Fc epsilon RI signaling pathway
    108591807
   04062 Chemokine signaling pathway
    108591807
  09152 Endocrine system
   04910 Insulin signaling pathway
    108591807
   04929 GnRH secretion
    108591807
   04912 GnRH signaling pathway
    108591807
   04915 Estrogen signaling pathway
    108591807
   04917 Prolactin signaling pathway
    108591807
   04921 Oxytocin signaling pathway
    108591807
   04926 Relaxin signaling pathway
    108591807
   04935 Growth hormone synthesis, secretion and action
    108591807
   04919 Thyroid hormone signaling pathway
    108591807
   04916 Melanogenesis
    108591807
  09156 Nervous system
   04725 Cholinergic synapse
    108591807
   04726 Serotonergic synapse
    108591807
   04720 Long-term potentiation
    108591807
   04730 Long-term depression
    108591807
   04722 Neurotrophin signaling pathway
    108591807
  09158 Development and regeneration
   04360 Axon guidance
    108591807
  09149 Aging
   04211 Longevity regulating pathway
    108591807
   04213 Longevity regulating pathway - multiple species
    108591807
  09159 Environmental adaptation
   04714 Thermogenesis
    108591807
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108591807
   05206 MicroRNAs in cancer
    108591807
   05205 Proteoglycans in cancer
    108591807
   05207 Chemical carcinogenesis - receptor activation
    108591807
   05208 Chemical carcinogenesis - reactive oxygen species
    108591807
   05203 Viral carcinogenesis
    108591807
   05230 Central carbon metabolism in cancer
    108591807
   05231 Choline metabolism in cancer
    108591807
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108591807
  09162 Cancer: specific types
   05210 Colorectal cancer
    108591807
   05225 Hepatocellular carcinoma
    108591807
   05226 Gastric cancer
    108591807
   05214 Glioma
    108591807
   05216 Thyroid cancer
    108591807
   05221 Acute myeloid leukemia
    108591807
   05220 Chronic myeloid leukemia
    108591807
   05218 Melanoma
    108591807
   05211 Renal cell carcinoma
    108591807
   05219 Bladder cancer
    108591807
   05215 Prostate cancer
    108591807
   05213 Endometrial cancer
    108591807
   05224 Breast cancer
    108591807
   05223 Non-small cell lung cancer
    108591807
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108591807
   05170 Human immunodeficiency virus 1 infection
    108591807
   05161 Hepatitis B
    108591807
   05160 Hepatitis C
    108591807
   05163 Human cytomegalovirus infection
    108591807
   05167 Kaposi sarcoma-associated herpesvirus infection
    108591807
   05165 Human papillomavirus infection
    108591807
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108591807
   05022 Pathways of neurodegeneration - multiple diseases
    108591807
  09165 Substance dependence
   05034 Alcoholism
    108591807
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108591807
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108591807
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108591807
   01522 Endocrine resistance
    108591807
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    108591807
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    108591807
   04031 GTP-binding proteins [BR:cjc04031]
    108591807
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    108591807
 Endocytosis
  Macropinocytosis
   Ras GTPases
    108591807
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108591807
  Exosomal proteins of other body fluids (saliva and urine)
   108591807
  Exosomal proteins of breast cancer cells
   108591807
  Exosomal proteins of colorectal cancer cells
   108591807
GTP-binding proteins [BR:cjc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    108591807
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha CbiA AAA_14 Aldo_ket_red
Other DBs
NCBI-GeneID: 108591807
NCBI-ProteinID: XP_054099445
LinkDB
Position
1:96269161..96277872
AA seq 164 aa
MTKYKLVVVGTGDVGKSTLTIQLIQNHFVDEYDPTIEDSYRKQVVIGGETCLLDILVTGG
QEEYSAMRDQYMRTGEYFLCVFAINNSEAFVDINLYREQIKQVKDSDDVPIVLVGNKCDL
PTRTVDTKQAHELAKSNGIPLIETSAKTRQGAEDAFYILVREIC
NT seq 495 nt   +upstreamnt  +downstreamnt
atgactaagtacaaactggtggtggttggaactggtgatgttgggaaaagcacgctgacc
atccagctaatccagaaccactttgtagatgagtatgatcccaccatagaggattcttac
agaaaacaggtggttataggtggtgaaacttgtctgttggacatactggttacaggtgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggagaatactttctctgt
gtatttgccatcaataatagtgaggcatttgtggatattaacctctatagggagcagatt
aagcaagtaaaagactcggatgatgtacctatagtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccatgaactggccaagagtaatgggattcca
ttaattgaaacctcagccaagaccagacagggtgctgaagatgctttttacatactggta
agagaaatatgctag

DBGET integrated database retrieval system