KEGG   Callithrix jacchus (white-tufted-ear marmoset): 118148021
Entry
118148021         CDS       T03264                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04114  Oocyte meiosis
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04744  Phototransduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05133  Pertussis
cjc05152  Tuberculosis
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05214  Glioma
cjc05417  Lipid and atherosclerosis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    118148021
   04015 Rap1 signaling pathway
    118148021
   04371 Apelin signaling pathway
    118148021
   04020 Calcium signaling pathway
    118148021
   04070 Phosphatidylinositol signaling system
    118148021
   04024 cAMP signaling pathway
    118148021
   04022 cGMP-PKG signaling pathway
    118148021
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    118148021
   04218 Cellular senescence
    118148021
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118148021
  09152 Endocrine system
   04910 Insulin signaling pathway
    118148021
   04922 Glucagon signaling pathway
    118148021
   04912 GnRH signaling pathway
    118148021
   04915 Estrogen signaling pathway
    118148021
   04921 Oxytocin signaling pathway
    118148021
   04916 Melanogenesis
    118148021
   04924 Renin secretion
    118148021
   04925 Aldosterone synthesis and secretion
    118148021
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118148021
   04270 Vascular smooth muscle contraction
    118148021
  09154 Digestive system
   04970 Salivary secretion
    118148021
   04971 Gastric acid secretion
    118148021
  09156 Nervous system
   04728 Dopaminergic synapse
    118148021
   04720 Long-term potentiation
    118148021
   04722 Neurotrophin signaling pathway
    118148021
  09157 Sensory system
   04744 Phototransduction
    118148021
   04740 Olfactory transduction
    118148021
   04750 Inflammatory mediator regulation of TRP channels
    118148021
  09159 Environmental adaptation
   04713 Circadian entrainment
    118148021
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118148021
  09162 Cancer: specific types
   05214 Glioma
    118148021
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    118148021
   05163 Human cytomegalovirus infection
    118148021
   05167 Kaposi sarcoma-associated herpesvirus infection
    118148021
  09171 Infectious disease: bacterial
   05133 Pertussis
    118148021
   05152 Tuberculosis
    118148021
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118148021
   05012 Parkinson disease
    118148021
   05022 Pathways of neurodegeneration - multiple diseases
    118148021
  09165 Substance dependence
   05031 Amphetamine addiction
    118148021
   05034 Alcoholism
    118148021
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118148021
   05418 Fluid shear stress and atherosclerosis
    118148021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    118148021
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    118148021
   03036 Chromosome and associated proteins [BR:cjc03036]
    118148021
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    118148021
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     118148021
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    118148021
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     118148021
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   118148021
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF-hand_11 EF_EFCAB10_C UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin FCaBP_EF-hand TerB MotA_activ DUF5580_M SurA_N_2
Other DBs
NCBI-GeneID: 118148021
NCBI-ProteinID: XP_035132007
LinkDB
Position
15:complement(50383515..50384504)
AA seq 149 aa
MADHLTEEQIAEFKEAFSLFDKDGDGAITTKELGTVMRSLGQNPTEAELQDMINEVDANG
NGTIDFPEFLTMMARKMKDTDSEEEIHESFRVFDKDGNDYISAAELRHVMTNLGEKLTDE
EVDEMIREADVDGDGQVNYEELVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgatcacctgaccgaagaacagattgctgaattcaaagaagctttctccctattc
gataaagatggcgatggcgccatcacaacaaaggaacttggaactgtcatgaggtcactg
ggtcaaaacccaacagaagctgagttgcaggatatgatcaacgaagtggatgctaatggt
aatggcaccattgacttccccgaatttttgactatgatggctagaaaaatgaaagataca
gatagtgaagaagaaatccatgagtcattccgagtctttgacaaggatggcaatgattac
attagtgcagcagaactacgtcacgtcatgacaaacttaggagaaaaactaacagatgaa
gaagtagatgaaatgatcagagaagcagatgttgatggagatggacaagtcaactatgaa
gaattagtacagatgatgactgcaaaatga

DBGET integrated database retrieval system