Campylobacter jejuni subsp. jejuni R14: H730_02780 Help Entry H730_02780        CDS       T03187                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cjer  Campylobacter jejuni subsp. jejuni R14 Pathway cjer01100   Metabolic pathways cjer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cjer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H730_02780 (acpP)    00074 Mycolic acid biosynthesis     H730_02780 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H730_02780 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  AHW91484 LinkDB All DBs Position 478368..478601 Genome browser AA seq 77 aa AA seqDB search MATFDDVKAVVVEQLSIDADAVKMESKIIEDLGADSLDVVELIMALEEKFEIEIPDSDAE KLIKIEDVVNYIDNLKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaacatttgatgatgtaaaagcagtagtagtagagcaattaagtattgatgcagat gcagttaaaatggaatcaaaaattattgaagatttaggtgctgattctttagatgttgta gagcttattatggctttagaagaaaaatttgaaatagaaattccagatagtgatgctgaa aaattaattaaaattgaagatgttgtaaattatattgacaatctaaaaaaataa

DBGET integrated database retrieval system