Campylobacter jejuni subsp. jejuni R14: H730_07460 Help Entry H730_07460        CDS       T03187                                  Name (GenBank) Putative acyl carrier protein   KO K02078   acyl carrier protein Organism cjer  Campylobacter jejuni subsp. jejuni R14 Pathway cjer01100   Metabolic pathways cjer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cjer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H730_07460    00074 Mycolic acid biosynthesis     H730_07460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H730_07460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Nrap_D4 Motif Other DBs NCBI-ProteinID:  AHW92327 LinkDB All DBs Position 1342685..1342906 Genome browser AA seq 73 aa AA seqDB search MTKTEFLEELKEAMHRDEDLNEDMLLDDIDEWDSLAFVSVMVLYKNLFTLKITAEDLKNC QKVSDLINLAKLD NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacaaaaactgaatttttagaagagcttaaagaagctatgcatagagatgaagactta aacgaggatatgctacttgatgatatagatgagtgggatagtttggcttttgtatctgtg atggtgctttataaaaatctttttactttaaaaatcacagccgaggacttgaaaaattgt caaaaagtaagtgatttaatcaatttagcaaagcttgattaa

DBGET integrated database retrieval system