Cryptomeria japonica (Japanese cedar): 131035426
Help
Entry
131035426 CDS
T10556
Name
(RefSeq) SKP1-like protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
cjf Cryptomeria japonica (Japanese cedar)
Pathway
cjf03083
Polycomb repressive complex
cjf04120
Ubiquitin mediated proteolysis
cjf04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
cjf00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
131035426
04120 Ubiquitin mediated proteolysis
131035426
09126 Chromosome
03083 Polycomb repressive complex
131035426
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
cjf04131
]
131035426
04121 Ubiquitin system [BR:
cjf04121
]
131035426
03036 Chromosome and associated proteins [BR:
cjf03036
]
131035426
Membrane trafficking [BR:
cjf04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
131035426
Ubiquitin system [BR:
cjf04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
131035426
Cul7 complex
131035426
Chromosome and associated proteins [BR:
cjf03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
131035426
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
131035426
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
VWA_3_C
Motif
Other DBs
NCBI-GeneID:
131035426
NCBI-ProteinID:
XP_057823107
LinkDB
All DBs
Position
7:complement(371255848..371256279)
Genome browser
AA seq
143 aa
AA seq
DB search
MAANIITLRLCKGTKDFEDFEVDKMVAMESEVIKNCIQDTHHGMEPLKLCLPSGHTEPVK
VLEKVLEYCDYHAHAKSSSISEEDVKIWDTDFTKNIMAADRNLGSVCHILKAADFLQIIG
LCNLLSKTIANFIKDNFLRDGTE
NT seq
432 nt
NT seq
+upstream
nt +downstream
nt
atggcagcgaatatcattacattgaggctgtgcaaaggtacgaaagactttgaagatttc
gaggtggataaaatggttgcaatggaatcagaggtcataaagaattgtatccaagacact
catcatgggatggagcctctaaagctttgtcttccttccggtcacaccgaacctgtcaaa
gttctggagaaagtattagagtattgtgactaccatgctcatgcaaaatccagcagtata
tcagaagaagatgtgaagatatgggatacggactttactaaaaatattatggctgccgat
cgaaatctggggtctgtctgtcacattcttaaggctgctgattttcttcaaattattggc
ttgtgtaatttgttatctaagactattgcaaatttcattaaggacaattttttaagagat
ggaacagaataa
DBGET
integrated database retrieval system