KEGG   Cryptomeria japonica (Japanese cedar): 131035427
Entry
131035427         CDS       T10556                                 
Name
(RefSeq) SKP1-like protein 14
  KO
K03094  S-phase kinase-associated protein 1
Organism
cjf  Cryptomeria japonica (Japanese cedar)
Pathway
cjf03083  Polycomb repressive complex
cjf04120  Ubiquitin mediated proteolysis
cjf04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cjf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    131035427
   04120 Ubiquitin mediated proteolysis
    131035427
  09126 Chromosome
   03083 Polycomb repressive complex
    131035427
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjf04131]
    131035427
   04121 Ubiquitin system [BR:cjf04121]
    131035427
   03036 Chromosome and associated proteins [BR:cjf03036]
    131035427
Membrane trafficking [BR:cjf04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    131035427
Ubiquitin system [BR:cjf04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     131035427
   Cul7 complex
     131035427
Chromosome and associated proteins [BR:cjf03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     131035427
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     131035427
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 131035427
NCBI-ProteinID: XP_059064680
LinkDB
Position
7:complement(371250393..371250896)
AA seq 167 aa
MAANTVTFRVLRDEEVYEDFEVEKAVAMESEVVKNFIEKDTGMEPLRFPIPCRNIKSGKV
LEMVLDYCKFHAHARSFTIPDDDVKTWDNEFAEKALSADKNQVTFCHILLAANFLEIEDL
FCLLLKAGADLLKDKSVEELRQIFKIENDFSEQEEEAIVQETKWTYA
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcggcgaatacagtgacattcagggtgttgagagatgaggaagtgtatgaagatttc
gaagtggaaaaagcggttgcaatggaatcagaggtcgtaaagaattttatagagaaagac
acaggaatggagcctctaaggtttcctattccttgtcgtaacatcaaaagcggcaaagta
ctggagatggtattagactactgtaaattccatgctcatgcaagatccttcactatacca
gatgacgatgtgaagacatgggataatgaattcgctgaaaaagctctttctgcggataaa
aatcaggtgaccttctgccacattcttttggctgctaattttcttgaaatcgaagatctt
ttttgtttgttattgaaggcaggggcagatttattgaaagacaaaagtgtggaagaattg
cgccagatatttaagatagagaatgatttcagtgaacaggaagaggaggcaatcgtgcaa
gagacgaagtggacctacgcataa

DBGET integrated database retrieval system