Cryptomeria japonica (Japanese cedar): 131039895
Help
Entry
131039895 CDS
T10556
Name
(RefSeq) SKP1-like protein 1A
KO
K03094
S-phase kinase-associated protein 1
Organism
cjf Cryptomeria japonica (Japanese cedar)
Pathway
cjf03083
Polycomb repressive complex
cjf04120
Ubiquitin mediated proteolysis
cjf04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
cjf00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
131039895
04120 Ubiquitin mediated proteolysis
131039895
09126 Chromosome
03083 Polycomb repressive complex
131039895
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
cjf04131
]
131039895
04121 Ubiquitin system [BR:
cjf04121
]
131039895
03036 Chromosome and associated proteins [BR:
cjf03036
]
131039895
Membrane trafficking [BR:
cjf04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
131039895
Ubiquitin system [BR:
cjf04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
131039895
Cul7 complex
131039895
Chromosome and associated proteins [BR:
cjf03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
131039895
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
131039895
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BTB
zf-primase
Motif
Other DBs
NCBI-GeneID:
131039895
NCBI-ProteinID:
XP_057828727
LinkDB
All DBs
Position
7:12328803..12329294
Genome browser
AA seq
163 aa
AA seq
DB search
MAEHPNTTMAKECKVKLKSKDDKIFEVEYAVAMQSQTLKNALAQTGCTDTTLPLHDISSQ
ILAKVIEYCEYHVNAANTTSEKDVKMWDEELVKHMDQDTLFRLIVAAKYLEIHNLVDLMC
KTIADRIKDKSVEELREIFHVQNDFTPEEEEQVRHETKWAHGE
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atggcagagcatcccaacacaaccatggcgaaagaatgtaaggtgaaattgaagagtaag
gatgacaagatattcgaggtagagtatgccgtagccatgcagtcgcagacgttaaagaac
gctctcgctcagacgggctgcacggataccaccctgcctttgcacgacatttccagtcaa
attttggcgaaggtgatcgagtactgcgaatatcatgttaatgccgccaacaccacctca
gagaaggatgtgaagatgtgggatgaggagttggtgaagcacatggatcaggataccctt
tttcgtctcattgttgctgcaaagtacctggaaatacacaatcttgtcgacttaatgtgc
aaaactatagcagacaggattaaggacaaaagcgtagaagagctcagagagatttttcac
gtacaaaatgacttcactccggaagaggaggaacaagtcaggcatgaaactaaatgggcg
catggggagtaa
DBGET
integrated database retrieval system