KEGG   Cryptomeria japonica (Japanese cedar): 131039922
Entry
131039922         CDS       T10556                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
cjf  Cryptomeria japonica (Japanese cedar)
Pathway
cjf03083  Polycomb repressive complex
cjf04120  Ubiquitin mediated proteolysis
cjf04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cjf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    131039922
   04120 Ubiquitin mediated proteolysis
    131039922
  09126 Chromosome
   03083 Polycomb repressive complex
    131039922
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjf04131]
    131039922
   04121 Ubiquitin system [BR:cjf04121]
    131039922
   03036 Chromosome and associated proteins [BR:cjf03036]
    131039922
Membrane trafficking [BR:cjf04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    131039922
Ubiquitin system [BR:cjf04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     131039922
   Cul7 complex
     131039922
Chromosome and associated proteins [BR:cjf03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     131039922
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     131039922
SSDB
Motif
Pfam: Skp1_POZ Skp1 SPEF2_D5
Other DBs
NCBI-GeneID: 131039922
NCBI-ProteinID: XP_057828749
LinkDB
Position
7:13182211..13182651
AA seq 146 aa
MVEDLTVAMAKECKVKLKSWDDNTFEVEYVVAMQSQLLNNALAETGTDNTVPLHNISSEI
LAKVIEYCEYHVNTANTISMQDVKMWEQEFVRDLDQATLCHLILGAQYMKIRNLLYLICQ
TVAERIKGKSPEEAREIFNIQNDLTP
NT seq 441 nt   +upstreamnt  +downstreamnt
atggtggaggatctcactgtagccatggcgaaggaatgtaaggtgaaattgaagagttgg
gatgacaatacttttgaggttgagtatgtcgtagccatgcagtcacagttgttgaacaac
gctctggctgagactggaacagacaacactgtgcctttacacaatatttctagcgaaata
ctggcgaaggtgatcgagtactgcgaatatcatgttaataccgctaacaccatctcgatg
caggatgtgaagatgtgggaacaggagttcgtgagggaccttgatcaagcaactctttgt
catctcatcttgggcgcccagtacatgaagatacgcaatcttctatacttaatatgccaa
actgtagcagagaggattaagggtaaaagcccagaagaggccagagagatatttaacata
caaaacgacttgactccttaa

DBGET integrated database retrieval system