KEGG   Cryptomeria japonica (Japanese cedar): 131069633
Entry
131069633         CDS       T10556                                 
Name
(RefSeq) SKP1-like protein 10
  KO
K03094  S-phase kinase-associated protein 1
Organism
cjf  Cryptomeria japonica (Japanese cedar)
Pathway
cjf03083  Polycomb repressive complex
cjf04120  Ubiquitin mediated proteolysis
cjf04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cjf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    131069633
   04120 Ubiquitin mediated proteolysis
    131069633
  09126 Chromosome
   03083 Polycomb repressive complex
    131069633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjf04131]
    131069633
   04121 Ubiquitin system [BR:cjf04121]
    131069633
   03036 Chromosome and associated proteins [BR:cjf03036]
    131069633
Membrane trafficking [BR:cjf04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    131069633
Ubiquitin system [BR:cjf04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     131069633
   Cul7 complex
     131069633
Chromosome and associated proteins [BR:cjf03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     131069633
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     131069633
SSDB
Motif
Pfam: Skp1_POZ DUF2868
Other DBs
NCBI-GeneID: 131069633
NCBI-ProteinID: XP_057861133
LinkDB
Position
11:256286397..256286966
AA seq 189 aa
MRALFRFVLSVAELSGLSSSTAMEGKTMILKTWDKQEFKVDESVIMQSEYLTDLMQDYEN
DKSYWEETSILSVPMYGISPRLLEKLLSFCNYHATAKSNNTTQEAVNEWEKSFVDELKGD
MPTLFCLLKVSHYLKVNHLYFLLCQTVADSLVECENTSDLQRLVTIPEVTEEIAQLFPVI
VSNEDNMIP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagagctttgtttcgtttcgttctatcagttgcagagctctctggtttaagttcatca
acagcaatggaaggcaaaacaatgattctcaagacttgggataaacaagaattcaaagtg
gatgaaagtgtgataatgcaatccgaataccttacagacttaatgcaagactacgagaat
gataagagctattgggaggaaacatcaattctaagtgtacccatgtatggcatctctccc
agattattggagaagttgctaagtttctgtaattatcatgccactgccaaatccaacaat
acaacccaggaggctgtgaatgaatgggaaaagtcgtttgttgatgaacttaaaggggat
atgccaactttattctgtcttctcaaggtttctcattacctaaaagtgaatcatctttat
tttctattatgtcaaactgttgctgattcgcttgtggaatgcgagaacacgagcgatctc
cagcgattagtcaccatacccgaagttacagaagagatcgcacagttgttccccgttatt
gtaagcaacgaagacaatatgatcccttga

DBGET integrated database retrieval system