Cryptomeria japonica (Japanese cedar): 131856772
Help
Entry
131856772 CDS
T10556
Name
(RefSeq) SKP1-like protein 11
KO
K03094
S-phase kinase-associated protein 1
Organism
cjf Cryptomeria japonica (Japanese cedar)
Pathway
cjf03083
Polycomb repressive complex
cjf04120
Ubiquitin mediated proteolysis
cjf04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
cjf00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
131856772
04120 Ubiquitin mediated proteolysis
131856772
09126 Chromosome
03083 Polycomb repressive complex
131856772
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
cjf04131
]
131856772
04121 Ubiquitin system [BR:
cjf04121
]
131856772
03036 Chromosome and associated proteins [BR:
cjf03036
]
131856772
Membrane trafficking [BR:
cjf04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
131856772
Ubiquitin system [BR:
cjf04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
131856772
Cul7 complex
131856772
Chromosome and associated proteins [BR:
cjf03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
131856772
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
131856772
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
zf-primase
Motif
Other DBs
NCBI-GeneID:
131856772
NCBI-ProteinID:
XP_059064676
LinkDB
All DBs
Position
7:complement(370201005..370201544)
Genome browser
AA seq
179 aa
AA seq
DB search
MFYLTRYQFISLITFVFRTAINSEVAFNSVKNKMAANIITLRLCKGTEGFEDFQVEKMVA
MESEVIKNCIQDTHHGMDPLRLPLPSGHVKPGKVLKKVLEYCEYHAHAKSNSISEDDVNI
WDTEFSQNIITADKNRASVCDILKAADFLIIDGLHNLLCITIVNFIKNKFEERAAILSR
NT seq
540 nt
NT seq
+upstream
nt +downstream
nt
atgttctatcttacccgttatcaattcatcagtttgataacatttgtttttcgtactgct
atcaattcagaagtcgcattcaattccgtgaagaacaaaatggcagcaaacatcattaca
ttgaggctgtgcaaaggtacggaaggttttgaagatttccaagtggagaaaatggttgca
atggaatcagaggtcataaagaactgtatccaagacacacatcatgggatggaccctcta
aggcttcctcttccttctggtcacgtcaagcctggtaaagtgctgaagaaagtattagag
tattgtgaataccatgctcatgctaaatccaacagtatatcagaagacgatgtgaacatc
tgggatacagaattctctcaaaatattattactgctgataaaaatcgggcgtctgtctgt
gatattcttaaggctgctgattttcttataatcgatggtctgcataatttgttatgtata
actatcgtaaatttcattaaaaacaaatttgaagagagggcagcaatcctgtcaaggtag
DBGET
integrated database retrieval system