KEGG   Cryptomeria japonica (Japanese cedar): 131872620
Entry
131872620         CDS       T10556                                 
Name
(RefSeq) SKP1-like protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
cjf  Cryptomeria japonica (Japanese cedar)
Pathway
cjf03083  Polycomb repressive complex
cjf04120  Ubiquitin mediated proteolysis
cjf04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cjf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    131872620
   04120 Ubiquitin mediated proteolysis
    131872620
  09126 Chromosome
   03083 Polycomb repressive complex
    131872620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjf04131]
    131872620
   04121 Ubiquitin system [BR:cjf04121]
    131872620
   03036 Chromosome and associated proteins [BR:cjf03036]
    131872620
Membrane trafficking [BR:cjf04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    131872620
Ubiquitin system [BR:cjf04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     131872620
   Cul7 complex
     131872620
Chromosome and associated proteins [BR:cjf03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     131872620
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     131872620
SSDB
Motif
Pfam: Skp1_POZ NBAS_11th VWA_3_C zf-primase
Other DBs
NCBI-GeneID: 131872620
NCBI-ProteinID: XP_059072095
LinkDB
Position
Unknown
AA seq 143 aa
MAANIITLRLCKGTKDFEDFEVERMVAMESEVIKNCIQDTHHGMEPLKLCLPSGHTEPVK
VLEKVLEYCEYHAHAKSNSISEEDVKIWDTDFAKNIMAADRNLGSVCHILKAADFLQIIG
LCNLLSKTIANFIKDNFFKDGTE
NT seq 432 nt   +upstreamnt  +downstreamnt
atggcagcgaatatcattacattgaggctgtgcaaaggtacgaaagactttgaagatttc
gaggtggagagaatggttgcaatggaatcagaagtcataaagaactgtatccaagacaca
catcatgggatggagcctctaaagctttgtcttccttccggtcacaccgaacctgtcaaa
gttctggagaaagtattagagtattgtgagtaccatgctcatgcaaaatccaacagtata
tcagaagaagatgtgaagatatgggatacggactttgctaaaaatattatggctgccgat
cgaaatctggggtctgtctgtcacattcttaaggctgctgattttcttcaaattattggc
ttgtgtaatttgttatctaagactattgcaaatttcattaaggacaatttttttaaagat
ggaacagaataa

DBGET integrated database retrieval system