Kaistella jeonii: NCTC13459_01818 Help Entry NCTC13459_01818   CDS       T06863                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cjg  Kaistella jeonii Pathway cjg01100   Metabolic pathways cjg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cjg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC13459_01818    00074 Mycolic acid biosynthesis     NCTC13459_01818   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC13459_01818 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  VEI96189 LinkDB All DBs Position 1:complement(1929813..1930049) Genome browser AA seq 78 aa AA seqDB search MTNEEILEKLTGIFHDELDNEDIILSRETAADDIEEWDSLSHIQLIVAVEKAFKVRFTSS EIQSWNNVGEMIDCILSK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaccaacgaagaaattttagaaaaattaacaggtatttttcacgacgaattagataac gaagatattattttgagtagagaaaccgctgcagacgatatcgaagaatgggattcttta tctcatattcagttgatcgtggcggtagaaaaagcttttaaagtacgttttacttcttca gaaatccagagctggaataatgtgggagaaatgatcgattgtattttatctaaataa

DBGET integrated database retrieval system