Corynebacterium jeddahense: CJEDD_05490 Help Entry CJEDD_05490       CDS       T08816                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism cjh  Corynebacterium jeddahense Pathway cjh00190   Oxidative phosphorylation cjh01100   Metabolic pathways Module cjh_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cjh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CJEDD_05490 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cjh00194]     CJEDD_05490 (atpE) Photosynthesis proteins [BR:cjh00194]  Photosystem and electron transport system   F-type ATPase [OT]    CJEDD_05490 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WCZ38708 UniProt:  A0ABY7UIY1 LinkDB All DBs Position 1128630..1128875 Genome browser AA seq 81 aa AA seqDB search MNDIILAQAAETVNRYEGLGTIGYGLATIGPGLGIGILVGKTVEGMARQPEMAGQLRTTM FLGIAFVEALALIGLVAGFLF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaacgacatcattcttgcccaggcagcggagaccgtgaaccgttacgagggtctcggc accatcggctacggcctcgccaccatcggcccgggcctcggcatcggcatcctcgtcggc aagaccgtcgagggcatggctcgccagccggagatggccggccagctccgcaccaccatg ttcctgggtatcgccttcgtcgaggcgctcgccctcatcggcctcgtcgccggcttcctg ttctaa

DBGET integrated database retrieval system