Coturnix japonica (Japanese quail): 107311643 Help Entry 107311643         CDS       T04297                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo04814   Motor proteins cjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cjo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     107311643 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107311643 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cjo03037]     107311643 (DYNLT1)    04812 Cytoskeleton proteins [BR:cjo04812]     107311643 (DYNLT1) Cilium and associated proteins [BR:cjo03037]  Motile cilia and associated proteins   Dynein arm    107311643 (DYNLT1) Cytoskeleton proteins [BR:cjo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      107311643 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  107311643 NCBI-ProteinID:  XP_015713828 UniProt:  A0A8C2T808 LinkDB All DBs Position 3:complement(47079891..47082983) Genome browser AA seq 113 aa AA seqDB search MDEFQAGEETSFVVDEVSNIIKEAIESAIGGNAYQHSKVNQWTTSVVEQSLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagttccaggcgggggaggagacatcttttgtcgtcgacgaagtcagtaacatc attaaagaggccatagaaagtgcaataggtggcaatgcctaccagcacagcaaggtgaac cagtggacaacaagtgtggtggaacaatctctaagccaactcaccaagctggggaaacct ttcaagtatattgtgacctgtgtgattatgcaaaagaatggcgctgggctacacacagca agctcttgcttttgggacaactccagtgatggaacctgcactgtgagatgggagaacaag actatgtactgtattgtcagtgcctttggactcgcaatatga

DBGET integrated database retrieval system