Coturnix japonica (Japanese quail): 107312312 Help Entry 107312312         CDS       T04297                                  Symbol UCN Name (RefSeq) urocortin   KO K23142   urocortin Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo04080   Neuroactive ligand-receptor interaction cjo04081   Hormone signaling Brite KEGG Orthology (KO) [BR:cjo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     107312312 (UCN)    04081 Hormone signaling     107312312 (UCN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cjo04052]     107312312 (UCN) Cytokines and neuropeptides [BR:cjo04052]  Neuropeptides   GPCR binding    107312312 (UCN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CRF Motif Other DBs NCBI-GeneID:  107312312 NCBI-ProteinID:  XP_015715104 UniProt:  A0A8C2TMM6 LinkDB All DBs Position 3:95415954..95416930 Genome browser AA seq 100 aa AA seqDB search MRRALLTVLLLLCRPFPAAPRPARPDGLDGPGSGVPAAEVRTEALWPPLPAEPWRARRDE PPLSIDLTFHLLRHLLLLARAQSQRARADNNRRILDAVGR NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcggcgggcgctgctcaccgttctgctgctgctgtgccgcccgttccccgccgccccc cgtcccgcccgccccgacggcctcgacggccccggctcgggagtccccgcggcggaagtg cggaccgaagcgctgtggccgccgctgcccgcagagccgtggagggcgcggagggacgag ccgccgctctccatcgacctcacgttccatctcctgcggcacctcctgctgctcgcccgc gcccagagccagcgcgcccgcgccgacaacaaccgccgcatcctcgacgccgtgggacgc tga

DBGET integrated database retrieval system