Coturnix japonica (Japanese quail): 107314402 Help Entry 107314402         CDS       T04297                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism cjo  Coturnix japonica (Japanese quail) Brite KEGG Orthology (KO) [BR:cjo00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cjo04147]     107314402 (CD59)    04090 CD molecules [BR:cjo04090]     107314402 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjo00537]     107314402 (CD59) Exosome [BR:cjo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107314402 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    107314402 (CD59)   Exosomal proteins of colorectal cancer cells    107314402 (CD59) CD molecules [BR:cjo04090]  Proteins   107314402 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjo00537]  Antigens   107314402 (CD59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  107314402 NCBI-ProteinID:  XP_015719077 LinkDB All DBs Position 5:6434356..6439149 Genome browser AA seq 119 aa AA seqDB search MIKMNCVLLTACIVLLAFSSSGYALRCYHCENSPSLCKTNSTCLSNEDTCLQMRFGKLRT SSCWKLSQCNMNDIAVYYQLDNFEYFCCQQDLCNEGTVTGVNKAAFSIASVMAMLWMLL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgatcaagatgaattgtgtcctgctaaccgcctgcattgttctgctcgctttctctagt tctggctatgccctgaggtgctatcactgtgagaacagcccttcattgtgcaagaccaac agcacttgcttatcaaatgaagacacttgcttgcaaatgagatttggtaaattgagaacg tcctcctgctggaagttgtctcagtgcaatatgaatgatattgctgtatactaccagttg gataattttgaatacttttgctgccaacaagatttgtgcaatgagggcacggttaccggg gttaacaaggcagctttcagtattgcctctgtaatggccatgttatggatgcttctgtag

DBGET integrated database retrieval system