Coturnix japonica (Japanese quail): 107314531 Help Entry 107314531         CDS       T04297                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo04010   MAPK signaling pathway cjo04068   FoxO signaling pathway cjo04081   Hormone signaling cjo04114   Oocyte meiosis cjo04140   Autophagy - animal cjo04150   mTOR signaling pathway cjo04810   Regulation of actin cytoskeleton cjo04910   Insulin signaling pathway cjo04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cjo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107314531 (INS)    04068 FoxO signaling pathway     107314531 (INS)    04150 mTOR signaling pathway     107314531 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     107314531 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107314531 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     107314531 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     107314531 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     107314531 (INS)    04914 Progesterone-mediated oocyte maturation     107314531 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cjo04052]     107314531 (INS) Cytokines and neuropeptides [BR:cjo04052]  Neuropeptides   Unclassified    107314531 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  107314531 NCBI-ProteinID:  XP_015719310 UniProt:  A0A8C2U8B5 LinkDB All DBs Position 5:complement(10805950..10810249) Genome browser AA seq 107 aa AA seqDB search MALWIRSLPLLALLIFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ PLVSNPLHGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcactgcctcttctggccctcctcattttttctggccctggg accagctacgcagctgcaaaccagcacctctgtggctcccacttagtggaggctctctac ctggtgtgtggagaacgtggcttcttctactcccccaaagcccgacgagatgttgagcag cctctagtgagcaatcccctgcatggtgaggcaggagtgctgccctttcagcaggaggaa tacgagaaggtcaagcgagggattgttgagcaatgctgccataatacgtgttccctctac caactggagaactactgcaactag

DBGET integrated database retrieval system