Coturnix japonica (Japanese quail): 107316146 Help Entry 107316146         CDS       T04297                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism cjo  Coturnix japonica (Japanese quail) Brite KEGG Orthology (KO) [BR:cjo00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cjo03037]     107316146 (BBIP1) Cilium and associated proteins [BR:cjo03037]  Primary cilia and associated proteins   BBSome    107316146 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  107316146 NCBI-ProteinID:  XP_015722865 LinkDB All DBs Position 6:complement(23096723..23099419) Genome browser AA seq 80 aa AA seqDB search MRVRSDGAIMPEGKGTIREVLPKQGQLAAEDTAGMVLCKPKVLPLKSVSLEKLEQLQRAA MEAMEASRPPEGSAGSQPRP NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcgtgtgcggtcagacggcgccatcatgccggaggggaagggaacgatccgggaggtg ctgcccaaacaagggcagctggcggcggaggacacggccggcatggtgctgtgcaagccc aaagtgctgcccctcaagtcggtgtcgctggagaagctggagcagctgcagcgcgcagcg atggaggcgatggaagcgtcgcggccgcccgagggctctgcgggctcccaaccgcggcca taa

DBGET integrated database retrieval system