Coturnix japonica (Japanese quail): 107317023 Help Entry 107317023         CDS       T04297                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo04010   MAPK signaling pathway cjo04012   ErbB signaling pathway cjo04068   FoxO signaling pathway cjo04137   Mitophagy - animal cjo04140   Autophagy - animal cjo04150   mTOR signaling pathway cjo04210   Apoptosis cjo04218   Cellular senescence cjo04370   VEGF signaling pathway cjo04371   Apelin signaling pathway cjo04540   Gap junction cjo04625   C-type lectin receptor signaling pathway cjo04810   Regulation of actin cytoskeleton cjo04910   Insulin signaling pathway cjo04912   GnRH signaling pathway cjo04914   Progesterone-mediated oocyte maturation cjo04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cjo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107317023 (KRAS)    04012 ErbB signaling pathway     107317023 (KRAS)    04370 VEGF signaling pathway     107317023 (KRAS)    04371 Apelin signaling pathway     107317023 (KRAS)    04068 FoxO signaling pathway     107317023 (KRAS)    04150 mTOR signaling pathway     107317023 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107317023 (KRAS)    04137 Mitophagy - animal     107317023 (KRAS)   09143 Cell growth and death    04210 Apoptosis     107317023 (KRAS)    04218 Cellular senescence     107317023 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     107317023 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     107317023 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107317023 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     107317023 (KRAS)    04912 GnRH signaling pathway     107317023 (KRAS)    04914 Progesterone-mediated oocyte maturation     107317023 (KRAS)    04916 Melanogenesis     107317023 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cjo04131]     107317023 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:cjo04031]     107317023 (KRAS) Membrane trafficking [BR:cjo04131]  Endocytosis   Macropinocytosis    Ras GTPases     107317023 (KRAS) GTP-binding proteins [BR:cjo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107317023 (KRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  107317023 NCBI-ProteinID:  XP_015724699 UniProt:  A0A8C2Y603 LinkDB All DBs Position 1:complement(61748025..61772572) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRVKKISKEEKTPGC MKIKKCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataagcttgttgtcgttggagctggtggtgtgggcaagagcgccttgaca atacagctcattcagaaccactttgtggatgagtatgaccctaccatagaggattcctac agaaagcaagtagtaattgatggggaaacctgtctcttggatattcttgatacagcaggt caagaagaatatagcgcaatgagggaccaatatatgagaacaggagaaggctttctgtgt gtatttgctataaacaatacaaaatcttttgaagatattcaccattatagggaacaaata aaaagagttaaagactctgaagacgtcccaatggtgctagtaggaaacaaatgtgatttg ccttccagaacagtagatacaaaacaagctcaggatttagcaagaagttacggaattcct tttattgaaacatcagcaaagacaagacagagagtggaagatgctttttatacattggtg cgagagattcgacagtacagagtgaaaaaaatcagcaaagaagaaaagactccagggtgc atgaaaattaaaaaatgccttgtaatgtaa

DBGET integrated database retrieval system