Coturnix japonica (Japanese quail): 107318404 Help Entry 107318404         CDS       T04297                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo04810   Regulation of actin cytoskeleton cjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cjo00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     107318404 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107318404 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cjo04131]     107318404 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cjo04812]     107318404 (PFN2)    04147 Exosome [BR:cjo04147]     107318404 (PFN2) Membrane trafficking [BR:cjo04131]  Others   Actin-binding proteins    Others     107318404 (PFN2) Cytoskeleton proteins [BR:cjo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      107318404 (PFN2) Exosome [BR:cjo04147]  Exosomal proteins   Proteins found in most exosomes    107318404 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  107318404 NCBI-ProteinID:  XP_015727655 LinkDB All DBs Position 9:21115396..21120517 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtgggctactgcgacgccaagtacgtctgggcggccacggccggcggcatcttc cagagcatcacgccagtagaaatagatatgattgtagggaaggaccgggagggcttcttc accaacggcctgaccctcggtgcaaagaagtgctctgtgatcagagacagcctctacgtg gatggggactgcacgatggacatccggacgaagagccaaggcggggagccgacgtacaac gtggccgtgggcagagctggtcgagcattggttatagtcatgggaaaggaaggtgtccat ggagggacactcaacaagaaagcatatgaactggctttatacctgaggaggtctgacgtc taa

DBGET integrated database retrieval system