Coturnix japonica (Japanese quail): 107319226 Help Entry 107319226         CDS       T04297                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism cjo  Coturnix japonica (Japanese quail) Brite KEGG Orthology (KO) [BR:cjo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cjo03019]     107319226    03029 Mitochondrial biogenesis [BR:cjo03029]     107319226 Messenger RNA biogenesis [BR:cjo03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      107319226 Mitochondrial biogenesis [BR:cjo03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     107319226 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  107319226 NCBI-ProteinID:  XP_032303007 LinkDB All DBs Position 11:554693..555815 Genome browser AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactcccaggactgcccttgtgccaccggcggcacctgcacgtgcggggacaactgc aagtgtaaaaactgcaagtgcacatcgtgcaaaaaaggctgctgctcctgctgccctgca ggatgcgccaagtgtgcacagggctgtgtctgcaaagggcccccgtctgccaagtgcagc tgctgcaagtag

DBGET integrated database retrieval system