Coturnix japonica (Japanese quail): 107323601 Help Entry 107323601         CDS       T04297                                  Name (RefSeq) histone H2A.V   KO K11251   histone H2A Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo03082   ATP-dependent chromatin remodeling cjo04217   Necroptosis Brite KEGG Orthology (KO) [BR:cjo00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107323601  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107323601  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cjo03036]     107323601   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cjo04147]     107323601 Chromosome and associated proteins [BR:cjo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107323601 Exosome [BR:cjo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107323601 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  107323601 NCBI-ProteinID:  XP_015738349 LinkDB All DBs Position 22:883679..886304 Genome browser AA seq 113 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGRWHP NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcaggtgggaaggccggcaaggacagcgggaaggccaaggcgaaggcggtgtctcgc tctcagagagccggattgcagttccccgtgggccgcatccatcggcacctgaagacgcga accaccagccatgggcgggtcggggccacggccgccgtgtacagcgctgccatcctcgag tacctcactgctgaggtcctggagttggcaggtaacgcctccaaggatctcaaagtgaag cgcatcaccccgcgccatttgcagctggccatccgcggagacgaggagctggattccctc atcaaggccaccatagcggggggaggtaggtggcacccatag

DBGET integrated database retrieval system