Coturnix japonica (Japanese quail): 107324460 Help Entry 107324460         CDS       T04297                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo04814   Motor proteins cjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cjo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     107324460 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107324460 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cjo03037]     107324460 (DYNLT3)    04812 Cytoskeleton proteins [BR:cjo04812]     107324460 (DYNLT3) Cilium and associated proteins [BR:cjo03037]  Motile cilia and associated proteins   Dynein arm    107324460 (DYNLT3) Cytoskeleton proteins [BR:cjo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      107324460 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  107324460 NCBI-ProteinID:  XP_015739980 UniProt:  A0A8C2YEQ1 LinkDB All DBs Position 1:101997722..102003135 Genome browser AA seq 116 aa AA seqDB search MEDFHPHNDEMIFNADEAHNIVKDCIESVLGKADYNQNKVNQWTAAIVEQSLTHLVKLGK TYKYIVTCAVMQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggactttcacccccacaacgacgagatgatcttcaatgctgacgaggcccacaac atagttaaggattgcatagaaagtgttttaggcaaagcagattacaatcagaacaaagtc aaccagtggactgcagctatagtggaacaatcactgacacatttggtaaagctgggaaaa acgtataagtacattgtaacctgcgcagtgatgcagagaagcggagctggtctccacaca gcaagctcgtgcttctgggataccacgactgatgggacctgcacagtgagatgggaaaac cgaaccatgaactgcattgtcaacgtgtttgctgttgctattatcctgtag

DBGET integrated database retrieval system