Coturnix japonica (Japanese quail): 107324576 Help Entry 107324576         CDS       T04297                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism cjo  Coturnix japonica (Japanese quail) Pathway cjo04382   Cornified envelope formation cjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cjo00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     107324576 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107324576 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cjo04147]     107324576 (S100A10) Exosome [BR:cjo04147]  Exosomal proteins   Exosomal proteins of microglial cells    107324576 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  107324576 NCBI-ProteinID:  XP_015740189 UniProt:  A0A8C2SKL0 LinkDB All DBs Position 25:complement(2467356..2469871) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETLMFTFHKYAGDKNYLSKEDLRALMEKEFPGFLENQRDPMALDKIMKDLD QCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatcccaaatggagcacgccatggagacgctgatgttcaccttccacaaatatgcg ggtgacaagaactacctgagcaaggaggacctgcgtgccctgatggagaaggagttcccc ggattcctggagaaccagcgtgaccccatggctctggataagatcatgaaggacctggac cagtgccgggatggcaaagtgggattccagagcttcttctcactggtggctggactgacc atcgcctgcaacgactacttcgtggtgcacatgaagcagaaggggaggaagtga

DBGET integrated database retrieval system