Campylobacter jejuni subsp. jejuni S3: CJS3_0260 Help Entry CJS3_0260         CDS       T01856                                  Name (GenBank) Probable tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism cjs  Campylobacter jejuni subsp. jejuni S3 Pathway cjs00362   Benzoate degradation cjs01100   Metabolic pathways cjs01120   Microbial metabolism in diverse environments cjs01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:cjs00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CJS3_0260    00622 Xylene degradation     CJS3_0260    00621 Dioxin degradation     CJS3_0260 Enzymes [BR:cjs01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CJS3_0260 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 AbpB_N MIF Motif Other DBs NCBI-ProteinID:  ADT72024 LinkDB All DBs Position 246995..247201 Genome browser AA seq 68 aa AA seqDB search MPLVNIKLAKPSLSKEQKAELIADITKLLSTKYNKSKERVVVVLEDVENYDIGFGGESVE AIKAKAIK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccattggtaaatattaaattagcaaagccgtctttaagcaaggagcaaaaagcggag cttatagctgatattaccaaacttttaagcacgaaatataataaaagtaaagaaagagtt gtggtggttttagaagatgtagaaaattatgacataggctttggcggagaaagcgttgaa gctatcaaagcaaaggcaattaaatga

DBGET integrated database retrieval system