KEGG   Campylobacter jejuni subsp. jejuni MTVDSCj20: MTVDSCj20_0776
Entry
MTVDSCj20_0776    CDS       T03388                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
cjv  Campylobacter jejuni subsp. jejuni MTVDSCj20
Pathway
cjv00770  Pantothenate and CoA biosynthesis
cjv01100  Metabolic pathways
cjv01240  Biosynthesis of cofactors
Module
cjv_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cjv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MTVDSCj20_0776 (coaD)
Enzymes [BR:cjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     MTVDSCj20_0776 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AII24491
LinkDB
Position
complement(755039..755515)
AA seq 158 aa
MTCLYPGTFDPITNGHLDVIKRALKIFDEVIVAIAKSEHKKPCYDLEKRKELALLATQNL
KNVKIIAFDNLLVDLAKELKVNTIIRGLRAVSDFEYELQIGYANHALWEDMETIYLMPSL
KHAFISSSIVRSIVAHGGDVSSLVPKEILPFLKDQSCM
NT seq 477 nt   +upstreamnt  +downstreamnt
atgacttgtttatatcctgggacttttgatcctattaccaacgggcatttagatgttata
aaacgggctttaaaaatttttgatgaagtcatcgttgccatagcaaaaagtgaacataaa
aaaccttgctatgatttagaaaaacgcaaagaactagccctgcttgcaacacaaaattta
aaaaatgttaaaatcattgcttttgataatttacttgtagatttagccaaagaattaaaa
gttaatactataatccgtggacttagagcagtgagtgattttgaatacgaattgcaaatt
ggctatgcaaatcacgcactttgggaagatatggaaaccatttatcttatgccaagtcta
aaacatgcttttatttcaagttctattgttcgctctatagtagcacatgggggcgatgta
agttctcttgttccaaaagaaattctaccttttttaaaggatcaatcttgtatgtag

DBGET integrated database retrieval system