Campylobacter jejuni 32488: M635_02205 Help Entry M635_02205        CDS       T02759                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cjz  Campylobacter jejuni 32488 Pathway cjz01100   Metabolic pathways cjz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cjz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M635_02205    00074 Mycolic acid biosynthesis     M635_02205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M635_02205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Nrap_D4 Motif Other DBs NCBI-ProteinID:  AGQ94504 LinkDB All DBs Position 419100..419321 Genome browser AA seq 73 aa AA seqDB search MTKTEFLEELKEAMHRDEDLNEDMLLDDIDEWDSLAFVSVMVLYKNLFTLKITAEDLKNC QKVSDLINLAKLD NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacaaaaactgaatttttagaagagcttaaagaagctatgcatagagatgaagactta aacgaggatatgctacttgatgatatagatgagtgggatagtttggcttttgtatccgtg atggtgctttataaaaatctttttactttaaaaatcacagccgaggacttgaaaaattgt caaaaagtaagtgatttaatcaatttagcaaagcttgattaa

DBGET integrated database retrieval system