Comamonas kerstersii: B5M06_01260 Help Entry B5M06_01260       CDS       T04758                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism cke  Comamonas kerstersii Pathway cke00190   Oxidative phosphorylation cke01100   Metabolic pathways cke02020   Two-component system Module cke_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:cke00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     B5M06_01260  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     B5M06_01260 Enzymes [BR:cke01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      B5M06_01260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Asp-B-Hydro_N Motif Other DBs NCBI-ProteinID:  AQZ97090 UniProt:  A0A0W7Z3H5 LinkDB All DBs Position complement(267249..267377) Genome browser AA seq 42 aa AA seqDB search MWYFAWMLGLPLAAAFAVLNAMWFELMDDEATRKQLQDPSAG NT seq 129 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcttggatgctgggcctgccgctggctgcagcgtttgccgtactcaac gccatgtggtttgagctgatggacgatgaagccacccgcaagcagctgcaggacccgtcc gcaggctga

DBGET integrated database retrieval system