Citrobacter koseri: CKO_02885 Help Entry CKO_02885         CDS       T00592                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism cko  Citrobacter koseri Pathway cko02020   Two-component system cko02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:cko00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CKO_02885  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CKO_02885  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:cko02035]     CKO_02885 Bacterial motility proteins [BR:cko02035]  Flagellar system   Flagellar assembly proteins    Others     CKO_02885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ABV13991 UniProt:  A8AKH8 LinkDB All DBs Position 2672645..2672917 Genome browser AA seq 90 aa AA seqDB search MKVVANQYNLATAINKSSAAEQTRTVAQEGTKIERSAAIDPVLGDAQTQLSALPEVDMAR VAEMKDAISSGKIAVNLDSLTDAMQKYFQR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagtagcgaatcaatacaatctggcaaccgcaatcaacaagagcagcgccgca gaacagacccgcactgtcgctcaggaaggcacgaaaattgagcgcagcgccgcgatcgat ccggtactgggcgatgcgcaaacacaactctctgcgctgccggaagtggatatggcgcgc gtagctgaaatgaaagacgctatcagcagcggtaaaatcgcggttaacctcgattcgctg acggatgcgatgcagaagtatttccagaggtaa

DBGET integrated database retrieval system