Citrobacter koseri: CKO_03663 Help Entry CKO_03663         CDS       T00592                                  Name (GenBank) hypothetical protein   KO K03666   host factor-I protein Organism cko  Citrobacter koseri Pathway cko02024   Quorum sensing cko03018   RNA degradation Brite KEGG Orthology (KO) [BR:cko00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CKO_03663  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CKO_03663  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cko03019]     CKO_03663    03036 Chromosome and associated proteins [BR:cko03036]     CKO_03663 Messenger RNA biogenesis [BR:cko03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CKO_03663 Chromosome and associated proteins [BR:cko03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CKO_03663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ABV14742 UniProt:  A8AMM9 LinkDB All DBs Position complement(3403362..3403670) Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTSSNYHHGSSAQGTSAQQDSEETE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaaggtcaaatcgagtcttttgat caattcgtgatcctgttgaaaaacacggtcagccagatggtttacaagcacgcgatttct actgttgtcccgtctcgcccggtttctcatcacagtaacaatgccggtggcggcaccagc agtaactaccatcacggtagcagcgcgcagggtacttctgcgcaacaggacagcgaagaa accgaataa

DBGET integrated database retrieval system