Chitinimonas koreensis: H9L41_19350 Help Entry H9L41_19350       CDS       T08620                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cks  Chitinimonas koreensis Pathway cks01100   Metabolic pathways cks01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cks00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L41_19350    00074 Mycolic acid biosynthesis     H9L41_19350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L41_19350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNM95952 LinkDB All DBs Position complement(4593831..4594091) Genome browser AA seq 86 aa AA seqDB search MQALEHEIKALVIESLNLEDITPDDIDPTAALFVEGLGLDSIDALELGLALQKRYGVSMS ADSEETRKHFASVRALAEFVSASRTR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgcttgaacacgaaatcaaggcactcgtcatcgagtcgctcaacctcgaggac atcacgcccgacgacatcgacccgaccgcggcgctgttcgtcgaaggcctcggcctcgat tcgatcgacgcgctcgagctcggcctggcgctgcagaagcgctacggcgtgagcatgtcg gccgattcggaagagacgcgcaagcacttcgccagcgtgcgcgcgctggcggaattcgta tccgccagtcggacccgctga

DBGET integrated database retrieval system